SDS-PAGE
Protein atonal homolog 1 (Atoh1) Recombinant Protein | Atoh1 recombinant protein
Recombinant Mouse Protein atonal homolog 1 (Atoh1)
Gene Names
Atoh1; Hath1; Math1; MATH-1; bHLHa14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein atonal homolog 1 (Atoh1); Recombinant Mouse Protein atonal homolog 1 (Atoh1); Atoh1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351aa, Full Length
Sequence
MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS
Sequence Length
351
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for Atoh1 recombinant protein
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3
E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Product Categories/Family for Atoh1 recombinant protein
References
"A mammalian helix-loop-helix factor structurally related to the product of Drosophila proneural gene atonal is a positive transcriptional regulator expressed in the developing nervous system." Akazawa C., Ishibashi M., Shimizu C., Nakanishi S., Kageyama R. J. Biol. Chem. 270:8730-8738(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.9 kDa
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal bHLH transcription factor 1
NCBI Official Symbol
Atoh1
NCBI Official Synonym Symbols
Hath1; Math1; MATH-1; bHLHa14
NCBI Protein Information
protein atonal homolog 1
UniProt Protein Name
Protein atonal homolog 1
Protein Family
UniProt Gene Name
Atoh1
UniProt Synonym Gene Names
Ath1; mATH1
Uniprot Description
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Research Articles on Atoh1
Similar Products
Product Notes
The Atoh1 atoh1 (Catalog #AAA967641) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351aa, Full Length. The amino acid sequence is listed below: MSRLLHAEEW AEVKELGDHH RHPQPHHVPP LTPQPPATLQ ARDLPVYPAE LSLLDSTDPR AWLTPTLQGL CTARAAQYLL HSPELGASEA AAPRDEADSQ GELVRRSGCG GLSKSPGPVK VREQLCKLKG GVVVDELGCS RQRAPSSKQV NGVQKQRRLA ANARERRRMH GLNHAFDQLR NVIPSFNNDK KLSKYETLQM AQIYINALSE LLQTPNVGEQ PPPPTASCKN DHHHLRTASS YEGGAGASAV AGAQPAPGGG PRPTPPGPCR TRFSGPASSG GYSVQLDALH FPAFEDRALT AMMAQKDLSP SLPGGILQPV QEDNSKTSPR SHRSDGEFSP HSHYSDSDEA S. It is sometimes possible for the material contained within the vial of "Protein atonal homolog 1 (Atoh1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
