Autophagy-related protein 9 (atg9) Recombinant Protein | atg9 recombinant protein
Recombinant Schizosaccharomyces pombe Autophagy-related protein 9 (atg9)
Gene Names
atg9; apg9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 9 (atg9); Recombinant Schizosaccharomyces pombe Autophagy-related protein 9 (atg9); atg9 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-702aa; full length protein
Sequence
MFYQPAQNKKQYDDLADIEAQNNVPNTQEVLEAWQESLDSDEDESSPLEESNGFTISEHD DFVKSVPRKNNPTDLLYSGKLLDSDEPPSVHGNSSKVPSKHPSPSFPETTSLRNLQNGSK QKPALPNFNDPHFYNEDVTRSGHPNRSIYTQLPRNEFSNARVLWNRLSARDRVLWRWANV ENLDSFLQQVYTYYTGKGLSCIIVHRLFQILTVSFVIGFTTFITSCIDWPAVTPHGSLAG VTKSQCIAQMSPITYLVLWLFLSFLLALWIYYLTDIPRLWQMREFYIHALKIATADMPTV SWQRVLYRLLKLKNVNALTAEDGRVVSLHNMKRLDAYAIANRIMRKDNYFIALINNGIIN IELPLLHRRILTHTTEWNINWCIFNFVFDEQGQLRSAFRNPNSRKRLSEELRRRFIVAGF LNCLFAPIVAIYLVIHNFFRYFNEYHKNPGALSTRRYTPLALWTFREYNELQHFFDERIN DSYAAASHYVSQFPDFNMIRLFKYISFILGSFTAILVIITVFDPELMVTFEITKDRSVLF YLGLFGSLIAVSRSIIPDETLVFAPEKALRRVITFTHYMPGWWSDNMHSKAVQQEFCSLY SYRIVNLLWEILGILLTPVLLFFTFPSCSQDIVDFFREHTINVEGVGYVCSYAVFQDNPP YESVASLVQSRKISPLIQNKPELSRISFYEQFNTEAPRRDLR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for atg9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,705 Da
NCBI Official Full Name
autophagy associated protein Atg9
NCBI Official Symbol
atg9
NCBI Official Synonym Symbols
apg9
NCBI Protein Information
autophagy associated protein Atg9
UniProt Protein Name
Autophagy-related protein 9
Protein Family
UniProt Gene Name
atg9
UniProt Synonym Gene Names
apg9
UniProt Entry Name
ATG9_SCHPO
Uniprot Description
Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Required for mitophagy. Cycles between the PAS and the cytoplasmic vesicle pool and may participate in supplying membrane for the growing autophagosome. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Different machineries are required for anterograde trafficking to the PAS during either the Cvt pathway or bulk autophagy and for retrograde trafficking (). Has a role in meiosis and sporulation.
Similar Products
Product Notes
The atg9 atg9 (Catalog #AAA7008297) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-702aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the atg9 atg9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFYQPAQNKK QYDDLADIEA QNNVPNTQEV LEAWQESLDS DEDESSPLEE SNGFTISEHD DFVKSVPRKN NPTDLLYSGK LLDSDEPPSV HGNSSKVPSK HPSPSFPETT SLRNLQNGSK QKPALPNFND PHFYNEDVTR SGHPNRSIYT QLPRNEFSNA RVLWNRLSAR DRVLWRWANV ENLDSFLQQV YTYYTGKGLS CIIVHRLFQI LTVSFVIGFT TFITSCIDWP AVTPHGSLAG VTKSQCIAQM SPITYLVLWL FLSFLLALWI YYLTDIPRLW QMREFYIHAL KIATADMPTV SWQRVLYRLL KLKNVNALTA EDGRVVSLHN MKRLDAYAIA NRIMRKDNYF IALINNGIIN IELPLLHRRI LTHTTEWNIN WCIFNFVFDE QGQLRSAFRN PNSRKRLSEE LRRRFIVAGF LNCLFAPIVA IYLVIHNFFR YFNEYHKNPG ALSTRRYTPL ALWTFREYNE LQHFFDERIN DSYAAASHYV SQFPDFNMIR LFKYISFILG SFTAILVIIT VFDPELMVTF EITKDRSVLF YLGLFGSLIA VSRSIIPDET LVFAPEKALR RVITFTHYMP GWWSDNMHSK AVQQEFCSLY SYRIVNLLWE ILGILLTPVL LFFTFPSCSQ DIVDFFREHT INVEGVGYVC SYAVFQDNPP YESVASLVQS RKISPLIQNK PELSRISFYE QFNTEAPRRD LR. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 9 (atg9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
