Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable cysteine protease ATG4 (ATG4) Recombinant Protein | ATG4 recombinant protein

Recombinant Vanderwaltozyma polyspora Probable cysteine protease ATG4 (ATG4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable cysteine protease ATG4 (ATG4); Recombinant Vanderwaltozyma polyspora Probable cysteine protease ATG4 (ATG4); ATG4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-411, Full length protein
Sequence
MELSQKEIGLDRSKDDNGLSSNDYVVLGIHYPIDSDDDKVVELANKRSNSAGGSIGMFQQFFNKVEEFDYHPGFLSDVISRIHFTYRTKFIPIARSDDGPSPLRINFLIGDNPFNAIENAIYNPNCFNTDIGWGCMIRTGQSLLANAIQIAILGREFRVNDGDVNEQERKIISWFMDTPDEPFSLHNFVKKGCELSSKKPGEWFGPAATSRSIQSLVEQFPDCGIDRCIVSVSSADIFKDEINDIFKNKRYSNILLLMGVKLGVDKVNEYYLKDIRKILESRYSVGISGGRPSSSLYFFGYQDDTLLYFDPHKPQPSTIESLLETCHTDNFDKINISDMDPSMLIGVLLQGEDDWQSWSNEVFDSKIINILNSRNDVTIAEDSMSLEETLEPPDNEYVDLGPMSQQLNGSP
Sequence Length
411
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,394 Da
NCBI Official Full Name
hypothetical protein Kpol_1015p1
NCBI Official Symbol
Kpol_1015p1
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Probable cysteine protease ATG4
UniProt Gene Name
ATG4

Uniprot Description

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS ().

Similar Products

Product Notes

The ATG4 atg4 (Catalog #AAA1214512) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-411, Full length protein. The amino acid sequence is listed below: MELSQKEIGL DRSKDDNGLS SNDYVVLGIH YPIDSDDDKV VELANKRSNS AGGSIGMFQQ FFNKVEEFDY HPGFLSDVIS RIHFTYRTKF IPIARSDDGP SPLRINFLIG DNPFNAIENA IYNPNCFNTD IGWGCMIRTG QSLLANAIQI AILGREFRVN DGDVNEQERK IISWFMDTPD EPFSLHNFVK KGCELSSKKP GEWFGPAATS RSIQSLVEQF PDCGIDRCIV SVSSADIFKD EINDIFKNKR YSNILLLMGV KLGVDKVNEY YLKDIRKILE SRYSVGISGG RPSSSLYFFG YQDDTLLYFD PHKPQPSTIE SLLETCHTDN FDKINISDMD PSMLIGVLLQ GEDDWQSWSN EVFDSKIINI LNSRNDVTIA EDSMSLEETL EPPDNEYVDL GPMSQQLNGS P. It is sometimes possible for the material contained within the vial of "Probable cysteine protease ATG4 (ATG4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.