Autophagy-related protein 32 (ATG32) Recombinant Protein | ZYRO0G06666g recombinant protein
Recombinant Zygosaccharomyces rouxii Autophagy-related protein 32 (ATG32)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 32 (ATG32); Recombinant Zygosaccharomyces rouxii Autophagy-related protein 32 (ATG32); Recombinant Autophagy-related protein 32 (ATG32); Autophagy-related protein 32; ZYRO0G06666g recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-503
Sequence
MTSTEGTGGGDGKGISGFSDIERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALGYVML
Sequence Length
503
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,997 Da
NCBI Official Full Name
ZYRO0G06666p
NCBI Official Symbol
ZYRO0G06666g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Autophagy-related protein 32
UniProt Gene Name
ATG32
UniProt Entry Name
ATG32_ZYGRC
Uniprot Description
Function: Mitophagy-specific receptor that recruits the autophagic machinery to mitochondria and regulates selective degradation of mitochondria
By similarity.
Subcellular location: Mitochondrion outer membrane; Single-pass membrane protein
By similarity. Vacuole
By similarity. Note: Is imported into the vacuole along with mitochondria during starvation
By similarity.
Sequence similarities: Belongs to the ATG32 family.
Similar Products
Product Notes
The ZYRO0G06666g atg32 (Catalog #AAA1003924) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-503. The amino acid sequence is listed below: MTSTEGTGGG DGKGISGFSD IERRSILDPH LSVLELLRRP SDTRPHEALK GEVSDIVGNC AGTTGTGNGS ISQSWQTIHR NDSCLSVVPE RCPSQATAAG ILSSSDTSED EPDAVNSPSA VHQQLHATPP QKHTKSLEDY RSLNVGIPLV LPEDSNNINN NNKNGSTTGS NGEEDDNDTI TKSLNSSSNS FIMPKLSLSQ KTQKFRILVL GRPGLKFYHS IPKKYQHMFE LPRSHDPAEF KQYTGILVVF QELKEMVSLL NRVCQCNPNR PVIPVCQSGQ RQQVRNLLES LLKNRLVSLL YPPVVVNNQP DLLGMFRFLQ ELSKTVSDNS DMDAEEPNNG SKRLKRSLQR KKKKFIETSA ERNGRPHKKR HNNEKVNRWV LWGVSLTLGV GVGYCISHLV SSTWISLTTN PLGPVDPESV SKDLFVFDRQ ELKLGEMDMD SDHPFGHALF LFKQALKQWN LAVKQFLGRH LSCMERIGPA NCLEWPTSDE HTNRVLALGY VML. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 32 (ATG32), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
