Autophagy-related protein 17 (ATG17) Recombinant Protein | ATG17 recombinant protein
Recombinant Saccharomyces cerevisiae Autophagy-related protein 17 (ATG17)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 17 (ATG17); Recombinant Saccharomyces cerevisiae Autophagy-related protein 17 (ATG17); ATG17 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-417, Full length
Sequence
MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELFNIFKTLHEVIDDVNKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP
Sequence Length
417
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
48,639 Da
NCBI Official Full Name
Autophagy-related protein 17
UniProt Protein Name
Autophagy-related protein 17
Protein Family
UniProt Gene Name
ATG17
UniProt Synonym Gene Names
APG17
Uniprot Description
Autophagy-specific protein that functions with ATG13, ATG29, and CIS1/ATG31 in response to autophagy-inducing signals as a scaffold to recruit other ATG proteins to organize pre-autophagosomal structure (PAS) formation. Modulates the timing and magnitude of the autophagy response, such as the size of the sequestering vesicles, through interacting with and regulating ATG1 kinase activity. Plays particularly a role in pexophagy and nucleophagy. With ATG13, is required for ATG1 activation by autophosphorylation of 'Thr-226'. Recruits ATG9 to the pre-autophagosomal structure. Plays also a role in regulation of filamentous growth ().
Similar Products
Product Notes
The ATG17 atg17 (Catalog #AAA1259911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-417, Full length. The amino acid sequence is listed below: MNEADVTKFV NNARKTLTDA QLLCSSANLR IVDIKKKLSS WQLSISKLNF LIVGLRQQGK FLYTILKEGI GTKLIQKQWN QAVLVVLVDE MKYWQYEITS KVQRLDGIVN ELSISEKDDT DPSKLGDYIS RDNVNLLNDK LKEVPVIERQ IENIKLQYEN MVRKVNKELI DTKLTDVTQK FQSKFGIDNL METNVAEQFS RELTDLEKDL AEIMNSLTQH FDKTLLLQDK KIDNDEREEL FKVVQGDDKE LFNIFKTLHE VIDDVNKTIL NLGQFLQAKI KEKTELHSEV SEIINDFNRN LEYLLIFKDI SNLIDSFKNS CTQDIQTTKE LCEFYDNFEE SYGNLVLEAK RRKDVANRMK TILKDCEKQL QNLDAQDQEE RQNFIAENGT YLPETIWPGK IDDFSSLYTL NYNVKNP. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 17 (ATG17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
