Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cyclic AMP-dependent transcription factor ATF-4 (ATF4) Recombinant Protein | ATF4 recombinant protein

Recombinant Bovine Cyclic AMP-dependent transcription factor ATF-4 (ATF4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclic AMP-dependent transcription factor ATF-4 (ATF4); Recombinant Bovine Cyclic AMP-dependent transcription factor ATF-4 (ATF4); ATF4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-348, full length protein
Sequence
MAEMSFLSSEVLGGDFVSPFDQLGLGAEESLGLLDDNLEVAKHFKHHGFSCDKAKAGSSEWLAVDWLVSDNSKEDAFSGTDWMVEKMDLKEFDFDILFSKDDLETMPDELLATLDDTCDLFQPLVQETNKEPPQIVNPIGHLPEGLPTIDQGAPFTFFQPLPPSPGTLSSTPDHSFSLELCSEVVIPEGDSKPDSTTTGFPQCIKEEDAPSDNDSGICMSPDSSLGSPQDSPSTSRGSPNKSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDQIEEVRKAREKKRVL
Sequence Length
348
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATF4 recombinant protein
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). This protein belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,245 Da
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-4
NCBI Official Synonym Full Names
activating transcription factor 4
NCBI Official Symbol
ATF4
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-4
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-4
UniProt Gene Name
ATF4
UniProt Synonym Gene Names
cAMP-dependent transcription factor ATF-4

Uniprot Description

Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors.

Similar Products

Product Notes

The ATF4 atf4 (Catalog #AAA1438977) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-348, full length protein. The amino acid sequence is listed below: MAEMSFLSSE VLGGDFVSPF DQLGLGAEES LGLLDDNLEV AKHFKHHGFS CDKAKAGSSE WLAVDWLVSD NSKEDAFSGT DWMVEKMDLK EFDFDILFSK DDLETMPDEL LATLDDTCDL FQPLVQETNK EPPQIVNPIG HLPEGLPTID QGAPFTFFQP LPPSPGTLSS TPDHSFSLEL CSEVVIPEGD SKPDSTTTGF PQCIKEEDAP SDNDSGICMS PDSSLGSPQD SPSTSRGSPN KSLLSPGALS GSSRPKPYDP PGEKMVAAKV KGEKLDKKLK KMEQNKTAAT RYRQKKRAEQ EALTGECKEL EKKNEALKEK ADSLAKEIQY LKDQIEEVRK AREKKRVL. It is sometimes possible for the material contained within the vial of "Cyclic AMP-dependent transcription factor ATF-4 (ATF4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.