Dehydrodolichyl diphosphate synthase 3 (At5g58780) Recombinant Protein | At5g58780 recombinant protein
Recombinant Arabidopsis thaliana Dehydrodolichyl diphosphate synthase 3 (At5g58780)
Gene Names
cPT5; AtcPT5; AtHEPS; cis -prenyltransferase 5; HEPS; heptaprenyl diphosphate synthase; MZN1.33
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dehydrodolichyl diphosphate synthase 3 (At5g58780); Recombinant Arabidopsis thaliana Dehydrodolichyl diphosphate synthase 3 (At5g58780); At5g58780 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-302, Full length protein
Sequence
MLSILSSLLSLLFLFIISCFFITSHFWFPLSLPKILGFIKITSSRDDYDNEQRDEGTYVVGVEELQRELMPRHVAVIMDGNRRWAKRAGLLTSQGHEAGAKRLIEFSELCFKLGIHTVSAFAFSTENWGRHKIEVKCLMSLIQHYLKSKIQYFQREETRVSVIGNLTKIPESLLRTVQEIEEATRSYKKKHLILAIDYSGRLDILRACKSIVKKSEKGLIREEDVDEALIERELLTNCTEFPSPDLLIRTSGEQRISNFFLWQLAYTELFFSPVLWPDFDKDKLLEALVSYQRRERRFGCRV
Sequence Length
302
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,195 Da
NCBI Official Full Name
Undecaprenyl pyrophosphate synthetase family protein
NCBI Official Symbol
cPT5
NCBI Official Synonym Symbols
AtcPT5; AtHEPS; cis -prenyltransferase 5; HEPS; heptaprenyl diphosphate synthase; MZN1.33
NCBI Protein Information
Undecaprenyl pyrophosphate synthetase family protein
UniProt Protein Name
Dehydrodolichyl diphosphate synthase 3
Protein Family
UniProt Gene Name
At5g58780
UniProt Synonym Gene Names
Dedol-PP synthase 3
NCBI Description
Encodes a novel Z,E-mixed heptaprenyl diphosphate (Z,E-HepPP) synthase, which may be responsible for short-chain betulaprenols. It catalyzes the formation of C 35 short-chain polyisoprenoids in which the optimal allylic substrate was E,E-FPP. It may have a role in response to cold stress in root.
Uniprot Description
Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.
Research Articles on At5g58780
Similar Products
Product Notes
The At5g58780 at5g58780 (Catalog #AAA1412317) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-302, Full length protein. The amino acid sequence is listed below: MLSILSSLLS LLFLFIISCF FITSHFWFPL SLPKILGFIK ITSSRDDYDN EQRDEGTYVV GVEELQRELM PRHVAVIMDG NRRWAKRAGL LTSQGHEAGA KRLIEFSELC FKLGIHTVSA FAFSTENWGR HKIEVKCLMS LIQHYLKSKI QYFQREETRV SVIGNLTKIP ESLLRTVQEI EEATRSYKKK HLILAIDYSG RLDILRACKS IVKKSEKGLI REEDVDEALI ERELLTNCTE FPSPDLLIRT SGEQRISNFF LWQLAYTELF FSPVLWPDFD KDKLLEALVS YQRRERRFGC RV. It is sometimes possible for the material contained within the vial of "Dehydrodolichyl diphosphate synthase 3 (At5g58780), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
