Zinc finger CCCH domain-containing protein 53 (At5g07060) Recombinant Protein | At5g07060 recombinant protein
Recombinant Arabidopsis thaliana Zinc finger CCCH domain-containing protein 53 (At5g07060)
Gene Names
MAC5C; MOJ9.23; MOJ9_23; MOS4-associated complex subunit 5C
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger CCCH domain-containing protein 53 (At5g07060); Recombinant Arabidopsis thaliana Zinc finger CCCH domain-containing protein 53 (At5g07060); At5g07060 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-363, Full length protein
Sequence
MSHRDHGADGWESADFPITCESCFGDNPYMRMTRADYDKECKICSRPFTAFRWRPGRNARFKKTEICQTCSKLKNVCQVCLLDLGFGLPVQVRDSALNINSHYSVPMSHVNREYFADEHDPKTRAGLDYESSFGKMQPNDTILKLQRRTPSYEKNRPKICSFYTIGQCKRGAECSFRHEMPETGELSHQNIRDRYYSVNDPVAMKLLRKAGEMGTLEPPEDESIKTLYVGGLNSRIFEQDIHDHFYAYGEMESIRVMAEDGKYDQSGSNQQQQGSIAHTGLISQQQNQHSQMQQYYMQPPPPNEYSHYPSMDTQRMGAAFSTQESDGSSTSENNRAYSSYSYPMPPHQPYPTPPPYIDIYIYI
Sequence Length
363
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,755 Da
NCBI Official Full Name
CCCH-type zinc fingerfamily protein with RNA-binding domain-containing protein
NCBI Official Symbol
MAC5C
NCBI Official Synonym Symbols
MOJ9.23; MOJ9_23; MOS4-associated complex subunit 5C
NCBI Protein Information
CCCH-type zinc fingerfamily protein with RNA-binding domain-containing protein
UniProt Protein Name
Zinc finger CCCH domain-containing protein 53
Protein Family
UniProt Gene Name
At5g07060
UniProt Synonym Gene Names
AtC3H53
NCBI Description
Encodes MAC5C, homologous to MAC5A. MAC5A is a component of the MOS4-associated complex (MAC) that contributes to snc1- mediated autoimmunity. Homologues include AT1G07360 (MAC5A), AT2G29580 (MAC5B) and AT5G07060 (MAC5C). MAC5A and MAC5B are more closely related to each other than to MAC5C.
Similar Products
Product Notes
The At5g07060 at5g07060 (Catalog #AAA1373763) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-363, Full length protein. The amino acid sequence is listed below: MSHRDHGADG WESADFPITC ESCFGDNPYM RMTRADYDKE CKICSRPFTA FRWRPGRNAR FKKTEICQTC SKLKNVCQVC LLDLGFGLPV QVRDSALNIN SHYSVPMSHV NREYFADEHD PKTRAGLDYE SSFGKMQPND TILKLQRRTP SYEKNRPKIC SFYTIGQCKR GAECSFRHEM PETGELSHQN IRDRYYSVND PVAMKLLRKA GEMGTLEPPE DESIKTLYVG GLNSRIFEQD IHDHFYAYGE MESIRVMAED GKYDQSGSNQ QQQGSIAHTG LISQQQNQHS QMQQYYMQPP PPNEYSHYPS MDTQRMGAAF STQESDGSST SENNRAYSSY SYPMPPHQPY PTPPPYIDIY IYI. It is sometimes possible for the material contained within the vial of "Zinc finger CCCH domain-containing protein 53 (At5g07060), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
