Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial (At4g20930) Recombinant Protein | At4g20930 recombinant protein

Recombinant Arabidopsis thaliana Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial (At4g20930)

Gene Names

AT4G20930; T13K14.90; T13K14_90

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable 3-hydroxyisobutyrate dehydrogenase; mitochondrial (At4g20930); Recombinant Arabidopsis thaliana Probable 3-hydroxyisobutyrate dehydrogenase; At4g20930 recombinant protein

Ordering
Cat. Num. AAA1360832 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

35-347, Full length protein

Sequence

NQFQNVGFIGLGNMGFRMVNNLIRAGYKVTVHDINRDVMKMFTEMGVSSRETPYEVAQDSEVVITMLPSSSHVMDVYTGTNGLLLGENDIRPALFIDSSTIDPQTTRKISLAVSNCNLKEKRDNWEKPVMLDAPVSGGVLAAEAGTLTFMVGGPEDAYLAARPILQSMGRTSIYCGGSGNGSAAKICNNLAMAVSMLGTSEALALGQSLGISASTLTEVLNTSSGRCWSSDAYNPVPGVMKGVPSSRDYNGGFASKLMAKDLNLAAASAEEVGHKSPLISKAQEIYKKMCEEGHETKDFSCVFRHFYNGKDEV

Sequence Length

313

Species

Arabidopsis thaliana (Mouse-ear cress)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

18415593

NCBI GeneID

827841

NCBI Accession #

NP_567617.1

NCBI GenBank Nucleotide #

NM_118211.5

UniProt Accession #

Q9SUC0; Q1ECP8; Q8LC25

Molecular Weight

37,365 Da

NCBI Official Full Name

6-phosphogluconate dehydrogenase family protein

NCBI Official Symbol

AT4G20930

NCBI Official Synonym Symbols

T13K14.90; T13K14_90

NCBI Protein Information

6-phosphogluconate dehydrogenase family protein

UniProt Protein Name

Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial

UniProt Gene Name

At4g20930

UniProt Synonym Gene Names

HIBADH

Similar Products

Product Notes

The At4g20930 at4g20930 (Catalog #AAA1360832) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-347, Full length protein. The amino acid sequence is listed below: NQFQNVGFIG LGNMGFRMVN NLIRAGYKVT VHDINRDVMK MFTEMGVSSR ETPYEVAQDS EVVITMLPSS SHVMDVYTGT NGLLLGENDI RPALFIDSST IDPQTTRKIS LAVSNCNLKE KRDNWEKPVM LDAPVSGGVL AAEAGTLTFM VGGPEDAYLA ARPILQSMGR TSIYCGGSGN GSAAKICNNL AMAVSMLGTS EALALGQSLG ISASTLTEVL NTSSGRCWSS DAYNPVPGVM KGVPSSRDYN GGFASKLMAK DLNLAAASAE EVGHKSPLIS KAQEIYKKMC EEGHETKDFS CVFRHFYNGK DEV. It is sometimes possible for the material contained within the vial of "Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial (At4g20930), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...