Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (At2g20420) Recombinant Protein | At2g20420 recombinant protein

Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (At2g20420)

Gene Names
AT2G20420; F11A3.3; F11A3_3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Succinyl-CoA ligase [ADP-forming] subunit beta; mitochondrial (At2g20420); Recombinant Arabidopsis thaliana Succinyl-CoA ligase [ADP-forming] subunit beta; At2g20420 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-421, Full length protein
Sequence
LNIHEYQGAELMGKYGVNVPKGVAASSLEEVKKAIQDVFPNESELVVKSQILAGGRGLGTFKSGLKGGVHIVKRDEAEEIAGKMLGQVLVTKQTGPQGKVVSKVYLCEKLSLVNEMYFSIILDRKSAGPLIIACKKGGTSIEDLAEKFPDMIIKVPIDVFAGITDEDAAKVVDGLAPKAADRKDSIEQVKKLYELFRKTDCTMLEINPLAETSTNQLVAADAKLNFDDNAAFRQKEVFAMRDPTQEDPREVAAAKVDLNYIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEHQVVEAFKILTSDDKVKAILVNIFGGIMKCDVIASGIVNAAKEVALKVPVVVRLEGTNVEQGKRILKESGMKLITADDLDDAAEKAVKALAH
Sequence Length
395
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,346 Da
NCBI Official Full Name
ATP citrate lyase (ACL) family protein
NCBI Official Symbol
AT2G20420
NCBI Official Synonym Symbols
F11A3.3; F11A3_3
NCBI Protein Information
ATP citrate lyase (ACL) family protein
UniProt Protein Name
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
UniProt Gene Name
At2g20420
UniProt Synonym Gene Names
SCS-beta

Uniprot Description

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit.

Similar Products

Product Notes

The At2g20420 at2g20420 (Catalog #AAA1048337) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-421, Full length protein. The amino acid sequence is listed below: LNIHEYQGAE LMGKYGVNVP KGVAASSLEE VKKAIQDVFP NESELVVKSQ ILAGGRGLGT FKSGLKGGVH IVKRDEAEEI AGKMLGQVLV TKQTGPQGKV VSKVYLCEKL SLVNEMYFSI ILDRKSAGPL IIACKKGGTS IEDLAEKFPD MIIKVPIDVF AGITDEDAAK VVDGLAPKAA DRKDSIEQVK KLYELFRKTD CTMLEINPLA ETSTNQLVAA DAKLNFDDNA AFRQKEVFAM RDPTQEDPRE VAAAKVDLNY IGLDGEIGCM VNGAGLAMAT MDIIKLHGGT PANFLDVGGN ASEHQVVEAF KILTSDDKVK AILVNIFGGI MKCDVIASGI VNAAKEVALK VPVVVRLEGT NVEQGKRILK ESGMKLITAD DLDDAAEKAV KALAH. It is sometimes possible for the material contained within the vial of "Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (At2g20420), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual