Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable histone chaperone ASF1A (ASF1A) Recombinant Protein | ASF1A recombinant protein

Recombinant Arabidopsis thaliana Probable histone chaperone ASF1A (ASF1A)

Gene Names
SGA2; ANTI- SILENCING FUNCTION 1A; ASF1A; AtSP7; F4N21.13; F4N21_13; SP7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable histone chaperone ASF1A (ASF1A); Recombinant Arabidopsis thaliana Probable histone chaperone ASF1A (ASF1A); ASF1A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-196, Full length protein
Sequence
MSAIKITNVAVLHNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVFQADPPDPSKIQEEDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDEQLKEEPPTKVLIDKVQRNILSDKPRVTKFPIDFHPEEEQTAATAAPPEQSDEQQPNVNGEAQVLPDQSVEPKPEES
Sequence Length
196
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,133 Da
NCBI Official Full Name
ASF1 like histone chaperone
NCBI Official Symbol
SGA2
NCBI Official Synonym Symbols
ANTI- SILENCING FUNCTION 1A; ASF1A; AtSP7; F4N21.13; F4N21_13; SP7
NCBI Protein Information
ASF1 like histone chaperone
UniProt Protein Name
Probable histone chaperone ASF1A
UniProt Gene Name
ASF1A
UniProt Synonym Gene Names
SGA2; SP7; Anti-silencing function 1a protein; AtSP7

NCBI Description

Located on the SSL2 region of Arabidopsis thaliana, which is homeologous to the Brassica S locus for self incompatibility. Expressed in both vegetative and reproductive organs suggesting AtSP7 might not be involved in self incompatibility. Its expression is regulated during cell cycle progression through E2F transcription factors. The protein interacts with acetylated histones H3 and H4 and HAM acetyltransferases, proteins known to be involved in cell cycle control and DNA repair.

Uniprot Description

Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly (). While encoded by a region of the Arabidopsis thaliana genome that is homologous to the Brassica S-locus for self incompatibility, this protein may not play the same role in Arabidopsis thaliana.

Research Articles on ASF1A

Similar Products

Product Notes

The ASF1A asf1a (Catalog #AAA1418021) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196, Full length protein. The amino acid sequence is listed below: MSAIKITNVA VLHNPAPFVS PFQFEISYEC LNSLKDDLEW KLIYVGSAED ETYDQLLESV LVGPVNVGNY RFVFQADPPD PSKIQEEDII GVTVLLLTCS YMGQEFLRVG YYVNNDYEDE QLKEEPPTKV LIDKVQRNIL SDKPRVTKFP IDFHPEEEQT AATAAPPEQS DEQQPNVNGE AQVLPDQSVE PKPEES. It is sometimes possible for the material contained within the vial of "Probable histone chaperone ASF1A (ASF1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.