Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) Recombinant Protein | Ssed_0920 recombinant protein

Recombinant Shewanella sediminis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Recombinant Shewanella sediminis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Recombinant Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF); Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-am; Ssed_0920 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-145
Sequence
MAHLTLSIRGLLLALMSVLLISVAQLSMKWGMGTLNQLWSDLVMLWQGEDYSSLFSQALAPVMAVGAGLFCYALSMACWVMALKRLPLSIAYPLLSLSYVLVYLGAVYLPWLNEPLSWVKGTGIFLILLGLIFVLPKKNQTSDKS
Sequence Length
145
Species
Shewanella sediminis (strain HAW-EB3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,984 Da
NCBI Official Full Name
hypothetical protein Ssed_0920
NCBI Official Symbol
Ssed_0920
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
UniProt Gene Name
arnF
UniProt Synonym Gene Names
L-Ara4N-phosphoundecaprenol flippase subunit ArnF
UniProt Entry Name
ARNF_SHESH

Uniprot Description

Function: Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane

By similarity. HAMAP-Rule MF_00538

Pathway: Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis. HAMAP-Rule MF_00538

Subunit structure: Heterodimer of ArnE and ArnF

By similarity. HAMAP-Rule MF_00538

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_00538.

Sequence similarities: Belongs to the ArnF family.

Similar Products

Product Notes

The Ssed_0920 arnf (Catalog #AAA1219544) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-145. The amino acid sequence is listed below: MAHLTLSIRG LLLALMSVLL ISVAQLSMKW GMGTLNQLWS DLVMLWQGED YSSLFSQALA PVMAVGAGLF CYALSMACWV MALKRLPLSI AYPLLSLSYV LVYLGAVYLP WLNEPLSWVK GTGIFLILLG LIFVLPKKNQ TSDKS. It is sometimes possible for the material contained within the vial of "Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.