Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromosome initiation inhibitor (iciA) Recombinant Protein | iciA recombinant protein

Recombinant Escherichia coli Chromosome initiation inhibitor (iciA)

Gene Names
argP; can; canR; ECK2912; iciA; JW2883
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chromosome initiation inhibitor (iciA); Recombinant Escherichia coli Chromosome initiation inhibitor (iciA); iciA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-297, full length protein
Sequence
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIRLNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLDYGHKVLRQD
Sequence Length
297
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,472 Da
NCBI Official Full Name
transcriptional regulator for arginine transport and DNA replication genes; replication initiation inhibitor
NCBI Official Symbol
argP
NCBI Official Synonym Symbols
can; canR; ECK2912; iciA; JW2883
NCBI Protein Information
transcriptional regulator for arginine transport and DNA replication genes; replication initiation inhibitor
UniProt Protein Name
HTH-type transcriptional regulator ArgP
UniProt Gene Name
argP

NCBI Description

ArgP(IciA) is a LysR family transcriptional regulator. argP mutants are canavanine sensitive. argP is in the pho regulon. [More information is available at EcoGene: EG10490]. ArgP, "arginine protein," controls the transcription of genes involved in the arginine transport system and genes involved in DNA replication. [More information is available at EcoCyc: EG10490].

Uniprot Description

Controls the transcription of genes involved in arginine and lysine metabolism. Activates transcription of several genes, including argO, lysP, lysC, asd, dapB, dapD, lysA, gdhA and argK. Acts by binding directly to their promoter or control region (PubMed:10600368, PubMed:15150242, PubMed:17504942, PubMed:21441513, PubMed:21890697). ArgP dimer by itself is able to bind the argO promoter-operator region to form a binary complex, but the formation of a ternary complex with RNA polymerase is greatly stimulated only in presence of a coeffector. Both arginine and lysine are coeffectors at the argO promoter, but only arginine is competent to activate transcription. Lysine has repressive effects (PubMed:15150242, PubMed:17504942). ArgP also mediates lysine repression of dapB, and gdhA in vivo, but via an alternative mechanism: ArgP binding is directly reduced upon the addition of lysine (PubMed:21890697). Binds in vitro to the promoter region of dnaA and to the upstream region of the nrd promoter, but these genes are probably not regulated by ArgP in vivo (PubMed:9254708, PubMed:9819053, PubMed:21890697). In vitro, binds also to the three 13-mers located in the origin region (oriC) and blocks the initiation of replication (PubMed:1733927).

Research Articles on iciA

Similar Products

Product Notes

The iciA argp (Catalog #AAA1153099) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-297, full length protein. The amino acid sequence is listed below: MKRPDYRTLQ ALDAVIRERG FERAAQKLCI TQSAVSQRIK QLENMFGQPL LVRTVPPRPT EQGQKLLALL RQVELLEEEW LGDEQTGSTP LLLSLAVNAD SLATWLLPAL APVLADSPIR LNLQVEDETR TQERLRRGEV VGAVSIQHQA LPSCLVDKLG ALDYLFVSSK PFAEKYFPNG VTRSALLKAP VVAFDHLDDM HQAFLQQNFD LPPGSVPCHI VNSSEAFVQL ARQGTTCCMI PHLQIEKELA SGELIDLTPG LFQRRMLYWH RFAPESRMMR KVTDALLDYG HKVLRQD. It is sometimes possible for the material contained within the vial of "Chromosome initiation inhibitor (iciA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.