Arginine exporter protein ArgO (argO) Recombinant Protein | PC1_3686 recombinant protein
Recombinant Pectobacterium carotovorum subsp. carotovorum Arginine exporter protein ArgO (argO)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arginine exporter protein ArgO (argO); Recombinant Pectobacterium carotovorum subsp. carotovorum Arginine exporter protein ArgO (argO); Recombinant Arginine exporter protein ArgO (argO); Arginine exporter protein ArgO; PC1_3686 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-204
Sequence
MFAVFLQGALLGAAMILPLGPQNAFVMNQGIRRQYHLMVALLCALSDMVLITAGIFGGSALLSQSSLLLGAVTWGGVAFLLWFGWGAMKTAFSKNIVLASAEVMKQSRWRIIATMLAVTWLNPHVYLDTFVVLGSLGSQFAGDARSWFALGTMTASFTWFFALALLASWLAPWLNTPRVQRVINFFVGVVMWGIALQLARHGWQ
Sequence Length
204
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,345 Da
NCBI Official Full Name
L-lysine exporter
NCBI Official Symbol
PC1_3686
NCBI Protein Information
L-lysine exporter
UniProt Protein Name
Arginine exporter protein ArgO
UniProt Gene Name
argO
UniProt Entry Name
ARGO_PECCP
Uniprot Description
Function: Involved in the export of arginine. Important to control the intracellular level of arginine and the correct balance between arginine and lysine
By similarity. HAMAP-Rule MF_01901
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01901.
Sequence similarities: Belongs to the LysE/ArgO transporter (TC 2.A.75) family. [View classification]
Similar Products
Product Notes
The PC1_3686 argo (Catalog #AAA1099845) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-204. The amino acid sequence is listed below: MFAVFLQGAL LGAAMILPLG PQNAFVMNQG IRRQYHLMVA LLCALSDMVL ITAGIFGGSA LLSQSSLLLG AVTWGGVAFL LWFGWGAMKT AFSKNIVLAS AEVMKQSRWR IIATMLAVTW LNPHVYLDTF VVLGSLGSQF AGDARSWFAL GTMTASFTWF FALALLASWL APWLNTPRVQ RVINFFVGVV MWGIALQLAR HGWQ. It is sometimes possible for the material contained within the vial of "Arginine exporter protein ArgO (argO), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
