Arginase Recombinant Protein | ARG1 recombinant protein

Recombinant Human Arginase Protein

Cat. Num. AAA9141798

• Purity: >87% by SDS-PAGE.
• Synonyms: Arginase; Recombinant Human Arginase Protein; ARG1 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >87% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
• Sequence Length: 322

• Species: Human
• Endotoxin: < 0.01 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Arginase Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38 kDa.)

Related Product Information for ARG1 recombinant protein

Description: Recombinant Human Arginase Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met 1 - Lys 322) of human Arginase (Accession #NP_000036.2) fused with a 6xHis tag at the C-terminus.

Background: Arg1 also known as liver arginase, is a binuclear manganese metalloenzyme. It is a key enzyme of the urea cycle that catalyses the conversion of L-arginine into L-ornithine and urea, the final cytosolic reaction of urea formation in the mammalian liver. Arginase 1 is abundantly expressed in liver, but it is also expressed in cells and tissues that lack a complete urea cycle, including lung. Arginase is a critical regulator of nitric oxide synthesis and vascular function. It is implicated in a variety of human diseases including vascular disease, pulmonary disease, infectious disease, immune cell function and cancer. In humans, hereditary defects in arginase result in an accumulation of arginine in the blood known as hyperarginemia. Arginase deficiency can also result in the accumulation of nitrogen in the form of ammonia, which results in hyperammonemia.

Product Categories/Family for ARG1 recombinant protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 10947139
• NCBI GeneID: 383
• NCBI Accession #: NP_000036.2
• NCBI GenBank Nucleotide #: NP_000036.2
• UniProt Accession #: P05089
• NCBI Official Full Name: arginase-1 isoform 2
• NCBI Official Synonym Full Names: arginase 1
• NCBI Official Symbol: ARG1
• NCBI Protein Information: arginase-1
• UniProt Protein Name: Arginase-1
• Protein Family: Arginase
• UniProt Gene Name: ARG1
• UniProt Entry Name: ARGI1_HUMAN

NCBI Description

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

ARG1: Homotrimer. By arginine or homoarginine. Belongs to the arginase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Hydrolase; EC 3.5.3.1

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: extracellular space; neuron projection; cell soma; cytoplasm; cytosol; nucleus

Molecular Function: manganese ion binding; arginase activity

Biological Process: response to drug; mammary gland involution; maternal process involved in pregnancy; response to herbicide; liver development; response to amino acid stimulus; response to vitamin A; response to manganese ion; response to selenium ion; response to vitamin E; response to cadmium ion; response to zinc ion; response to methylmercury; arginine catabolic process; positive regulation of endothelial cell proliferation; response to axon injury; collagen biosynthetic process; response to amine stimulus; urea cycle; lung development

Disease: Argininemia