Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apolipoprotein L1 (APOL1) Recombinant Protein | APOL1 recombinant protein

Recombinant Human Apolipoprotein L1 (APOL1)

Gene Names
APOL1; APOL; APO-L; FSGS4; APOL-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein L1 (APOL1); Recombinant Human Apolipoprotein L1 (APOL1); APOL1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-398aa; Full-Length of the Mature Protein
Sequence
EEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for APOL1 recombinant protein
This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,158 Da
NCBI Official Full Name
apolipoprotein L1 isoform a
NCBI Official Synonym Full Names
apolipoprotein L1
NCBI Official Symbol
APOL1
NCBI Official Synonym Symbols
APOL; APO-L; FSGS4; APOL-I
NCBI Protein Information
apolipoprotein L1
UniProt Protein Name
Apolipoprotein L1
Protein Family
UniProt Gene Name
APOL1
UniProt Synonym Gene Names
APOL; Apo-L; ApoL; ApoL-I

NCBI Description

This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]

Uniprot Description

May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.

Research Articles on APOL1

Similar Products

Product Notes

The APOL1 apol1 (Catalog #AAA1175682) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-398aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: EEAGARVQQN VPSGTDTGDP QSKPLGDWAA GTMDPESSIF IEDAIKYFKE KVSTQNLLLL LTDNEAWNGF VAAAELPRNE ADELRKALDN LARQMIMKDK NWHDKGQQYR NWFLKEFPRL KSELEDNIRR LRALADGVQK VHKGTTIANV VSGSLSISSG ILTLVGMGLA PFTEGGSLVL LEPGMELGIT AALTGITSST MDYGKKWWTQ AQAHDLVIKS LDKLKEVREF LGENISNFLS LAGNTYQLTR GIGKDIRALR RARANLQSVP HASASRPRVT EPISAESGEQ VERVNEPSIL EMSRGVKLTD VAPVSFFLVL DVVYLVYESK HLHEGAKSET AEELKKVAQE LEEKLNILNN NYKILQADQE L. It is sometimes possible for the material contained within the vial of "Apolipoprotein L1 (APOL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.