Western Blot (WB)
(Host: RabbitTarget Name: DUX1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Rabbit DUX1 Polyclonal Antibody | anti-DUX1 antibody
DUX1 Antibody - N-terminal region
Reactivity
Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DUX1; Polyclonal Antibody; DUX1 Antibody - N-terminal region; anti-DUX1 antibody
Host
Rabbit
Reactivity
Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARET
Sequence Length
422
Applicable Applications for anti-DUX1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human DUX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DUX1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DUX1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-DUX1 antibody
This is a rabbit polyclonal antibody against DUX4L4. It was validated on Western Blot
Target Description: The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX1, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 606009).[supplied by OMIM, Mar 2008]
Target Description: The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX1, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 606009).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-DUX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
double homeobox protein 1
NCBI Official Synonym Full Names
double homeobox 1
NCBI Official Symbol
DUX1
NCBI Protein Information
double homeobox protein 1
UniProt Protein Name
Double homeobox protein 1
Protein Family
UniProt Gene Name
DUX1
UniProt Entry Name
DUX1_HUMAN
NCBI Description
The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX1, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 606009).[supplied by OMIM, Mar 2008]
Research Articles on DUX1
Similar Products
Product Notes
The DUX1 dux1 (Catalog #AAA3218399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUX1 Antibody - N-terminal region reacts with Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DUX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUX1 dux1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRPWPGRRGP PEGRRKRTAV TGSQTALLLR AFEKDRFPGI AAREELARET. It is sometimes possible for the material contained within the vial of "DUX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
