Apolipoprotein C-III Recombinant Protein | APOC3 recombinant protein

Recombinant Human Apolipoprotein C-III

Cat. Num. AAA968139

• Gene Names: APOC3; HALP2; APOCIII
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein C-III; Recombinant Human Apolipoprotein C-III; Apolipoprotein C3; APOC3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-99aa; Full Length of Mature Protein
• Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for APOC3 recombinant protein

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.

Product Categories/Family for APOC3 recombinant protein

Metabolism

References

Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.Protter A.A., Levy-Wilson B., Miller J., Bencen G., White T., Seilhamer J.J.DNA 3:449-456(1984) Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII.Levy-Wilson B., Appleby V., Protter A.A., Auperin D., Seilhamer J.J.DNA 3:359-364(1984) Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles.Karathanasis S.K., Zannis V.I., Breslow J.L.J. Lipid Res. 26:451-456(1985) Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.Sharpe C.R., Sidoli A., Shelley C.S., Lucero M.A., Shoulders C.C., Baralle F.E.Nucleic Acids Res. 12:3917-3932(1984) The effects of scale variation in the APOA1/C3/A4/A5 gene cluster.Fullerton S.M., Buchanan A.V., Sonpar V.A., Taylor S.L., Smith J.D., Carlson C.S., Salomaa V., Stengaard J.H., Boerwinkle E., Clark A.G., Nickerson D.A., Weiss K.M.Hum. Genet. 115:36-56(2004) Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects.Hospattankar A.V., Brewer H.B. Jr., Ronan R., Fairwell T.FEBS Lett. 197:67-73(1986) The complete amino acid sequence of alanine apolipoprotein (apoC-3) , and apolipoprotein from human plasma very low density lipoproteins.Brewer H.B. Jr., Shulman R., Herbert P., Ronan R., Wehrly K.J. Biol. Chem. 249:4975-4984(1974) An ABC of apolipoprotein C-III a clinically useful new cardiovascular risk factor?Chan D.C., Chen M.M., Ooi E.M., Watts G.F.Int. J. Clin. Pract. 62:799-809(2008) Enrichment of glycopeptides for glycan structure and attachment site identification.Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G.Nat. Methods 6:809-811(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Apolipoprotein C-III and hepatic triglyceride-rich lipoprotein production.Yao Z., Wang Y.Curr. Opin. Lipidol. 23:206-212(2012) Identification of new apolipoprotein-CIII glycoforms with ultrahigh resolution MALDI-FTICR mass spectrometry of human sera.Nicolardi S., van der Burgt Y.E., Dragan I., Hensbergen P.J., Deelder A.M.J. Proteome Res. 12:2260-2268(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Molecular cloning of a human apoC-III variant Thr 74-->Ala 74 mutation prevents O-glycosylation.Maeda H., Hashimoto R.K., Oguro T., Hiraga S., Uzawa H.J. Lipid Res. 28:1405-1409(1987) Apolipoprotein C-III(Lys-58-->Glu) . Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia.von Eckardstein A., Holz H., Sandkamp M., Weng W., Funke H., Assmann G.J. Clin. Invest. 87:1724-1731(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 4557323
• NCBI GeneID: 345
• NCBI Accession #: NP_000031.1
• NCBI GenBank Nucleotide #: NM_000040.1
• UniProt Accession #: P02656; Q08E83; Q6Q786
• Molecular Weight: 24.8 kDa
• NCBI Official Full Name: apolipoprotein C-III
• NCBI Official Synonym Full Names: apolipoprotein C-III
• NCBI Official Symbol: APOC3
• NCBI Official Synonym Symbols: HALP2; APOCIII
• NCBI Protein Information: apolipoprotein C-III
• UniProt Protein Name: Apolipoprotein C-III
• Protein Family: Apolipoprotein
• UniProt Gene Name: APOC3
• UniProt Synonym Gene Names: Apo-CIII; ApoC-III
• UniProt Entry Name: APOC3_HUMAN

NCBI Description

Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008]

Uniprot Description

APOC3: Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles. Defects in APOC3 are the cause of hyperalphalipoproteinemia type 2 (HALP2). HALP2 is a condition characterized by high levels of high density lipoprotein (HDL) and increased HDL cholesterol levels. Belongs to the apolipoprotein C3 family.

Protein type: Secreted; Secreted, signal peptide; Lipid-binding

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: chylomicron; early endosome; extracellular region; extracellular space

Molecular Function: cholesterol binding; enzyme regulator activity; lipase inhibitor activity; phospholipid binding

Biological Process: cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; fat-soluble vitamin metabolic process; G-protein coupled receptor protein signaling pathway; inflammatory response; lipoprotein metabolic process; lipoprotein transport; negative regulation of fatty acid biosynthetic process; negative regulation of lipid catabolic process; negative regulation of lipid metabolic process; negative regulation of lipoprotein lipase activity; negative regulation of receptor-mediated endocytosis; phospholipid efflux; phototransduction, visible light; regulation of Cdc42 protein signal transduction; response to peptide hormone stimulus; response to triglyceride; response to vitamin A; retinoid metabolic process; reverse cholesterol transport; triacylglycerol catabolic process; triacylglycerol metabolic process; triacylglycerol mobilization; vitamin metabolic process

Disease: Apolipoprotein C-iii Deficiency