(Rhesus macaque) Apolipoprotein A-II (APOA2) Recombinant Protein | APOA2 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) Apolipoprotein A-II (APOA2)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

(Rhesus macaque) Apolipoprotein A-II (APOA2); Recombinant Macaca mulatta (Rhesus macaque) Apolipoprotein A-II (APOA2); Recombinant (Rhesus macaque) Apolipoprotein A-II (APOA2); Apolipoprotein A-II; Apo-AII; ApoA-II; Apolipoprotein A2 Cleaved into the following chain: 1. Truncated apolipoprotein A-II; APOA2 recombinant protein

Ordering
Cat. Num. AAA966987 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-76

Sequence

QAEEPSVESLVSQYFQTVTDYGKDLMEKVKSPELQAQAKAYFEKSKEQLTPLVKKAGTDLVNFLSYFVELRTQPAT

Sequence Length

Species

Macaca mulatta (Rhesus macaque)

Preparation and Storage

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #

461520

UniProt Accession #

P02653

Molecular Weight

8,747 Da

NCBI Official Full Name

Apolipoprotein A-II

UniProt Protein Name

Apolipoprotein A-II

Protein Family

Apolipoprotein

UniProt Gene Name

APOA2

UniProt Synonym Gene Names

Apo-AII; ApoA-II

UniProt Entry Name

APOA2_MACMU

Uniprot Description

Function: Apo A-II makes up about 20% of the protein of the HDL (high density lipoprotein) phospholipid-rich fraction in plasma.

Subunit structure: Homodimer; disulfide-linked. Interacts with APOA1BP and NDRG1

By similarity.

Subcellular location: Secreted.

Tissue specificity: Plasma.

Post-translational modification: Met-26 is oxidized to methionine sulfoxide

By similarity.Phosphorylation sites are present in the extracellular medium

By similarity.

Sequence similarities: Belongs to the apolipoprotein A2 family.

Similar Products

Product Notes

The (Rhesus macaque) Apolipoprotein A-II (APOA2) apoa2 (Catalog #AAA966987) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-76. The amino acid sequence is listed below: QAEEPSVESL VSQYFQTVTD YGKDLMEKVK SPELQAQAKA YFEKSKEQLT PLVKKAGTDL VNFLSYFVEL RTQPAT. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Apolipoprotein A-II (APOA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...