Apolipoprotein A-I (APOA1) Recombinant Protein | APOA1 recombinant protein
Recombinant Bovine Apolipoprotein A-I (APOA1), Partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein A-I (APOA1); Recombinant Bovine Apolipoprotein A-I (APOA1); Partial; Apolipoprotein A1; Apo-AI; ApoA-I; APOA1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-265aa; Partial
Sequence
DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Sequence Length
265
Species
Bovine
Tag
N-terminal 6xHis-tagged
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for APOA1 recombinant protein
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase. As part of the SPAP complex, activates spermatozoa motility.
Product Categories/Family for APOA1 recombinant protein
References
"Characterization and amino-terminal sequence of apolipoprotein AI from plasma high density lipoproteins in the preruminant calf, Bos spp." Auboiron S., Sparrow D.A., Beaubatie L., Bauchart D., Sparrow J.T., Laplaud M.P., Chapman J.M. Biochem. Biophys. Res. Commun. 166:833-839(1990).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.6 kDa
NCBI Official Full Name
apolipoprotein A-I preproprotein
NCBI Official Synonym Full Names
apolipoprotein A1
NCBI Official Symbol
APOA1
NCBI Protein Information
apolipoprotein A-I
UniProt Protein Name
Apolipoprotein A-I
Protein Family
UniProt Gene Name
APOA1
UniProt Synonym Gene Names
Apo-AI; ApoA-I; ProapoA-I
Uniprot Description
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Research Articles on APOA1
Similar Products
Product Notes
The APOA1 apoa1 (Catalog #AAA7115182) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-265aa; Partial. The amino acid sequence is listed below: DDPQSSWDRV KDFATVYVEA IKDSGRDYVA QFEASALGKQ LNLKLLDNWD TLASTLSKVR EQLGPVTQEF WDNLEKETAS LRQEMHKDLE EVKQKVQPYL DEFQKKWHEE VEIYRQKVAP LGEEFREGAR QKVQELQDKL SPLAQELRDR ARAHVETLRQ QLAPYSDDLR QRLTARLEAL KEGGGSLAEY HAKASEQLKA LGEKAKPVLE DLRQGLLPVL ESLKVSILAA IDEASKKLNA Q. It is sometimes possible for the material contained within the vial of "Apolipoprotein A-I (APOA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
