Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apelin receptor B (aplnrb) Recombinant Protein | aplnrb recombinant protein

Recombinant Danio rerio Apelin receptor B (aplnrb)

Gene Names
aplnrb; grn; Agtrl1a; agtrl1b; zgc:114063
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apelin receptor B (aplnrb); Recombinant Danio rerio Apelin receptor B (aplnrb); Recombinant Apelin receptor B (aplnrb); Apelin receptor B; Angiotensin II receptor-like 1b Angiotensin receptor-like 1b G-protein coupled receptor APJ B Protein grinch; aplnrb recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-359
Sequence
MNAMDNMTADYSPDYFDDAVNSSMCEYDEWEPSYSLIPVLYMLIFILGLTGNGVVIFTVWRAQSKRRAADVYIGNLALADLTFVVTLPLWAVYTALGYHWPFGVALCKISSYVVLLNMYASVFCLTCLSLDRYMAIVHSLTSTQLRTRGHMRASLTAIWLLSGVLAAPTLLFRTTVYDVETNRTSCAMDFNLVVSQPGQETYWIAGLSISSTALGFLIPLLAMMVCYGFIGCTVTRHFNSLRKEDQRKRRLLKIITTLVVVFAACWMPFHVVKTMDALSYLNLAPDSCTFLNLLLLAHPYATCLAYVNSCLNPLLYAFFDLRFRSQCLCLLNLKKALHASPASSLSSQKTEAQSLATKV
Sequence Length
359
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,147 Da
NCBI Official Full Name
apelin receptor B
NCBI Official Synonym Full Names
apelin receptor b
NCBI Official Symbol
aplnrb
NCBI Official Synonym Symbols
grn; Agtrl1a; agtrl1b; zgc:114063
NCBI Protein Information
apelin receptor B; grinch; protein grinch; angiotensin receptor-like 1b; angiotensin II receptor-like 1b; G-protein coupled receptor APJ B
UniProt Protein Name
Apelin receptor B
Protein Family
UniProt Gene Name
aplnrb
UniProt Synonym Gene Names
agtrl1b; grn
UniProt Entry Name
APJB_DANRE

Uniprot Description

Function: Receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity

By similarity. Plays a role in gastrulation. Required for heart formation, regulating the migration of cells fated to become myocardial progenitors. Acts redundantly with agtrl1a in heart development. Ref.1 Ref.3 Ref.4 UniProtKB Q9JHG3

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Mesendodermal expression at the blastoderm margin appears by 4.5 hpf. At early gastrulation, expression is maintained ventrolaterally while expression in dorsal cells and random deep cells declines. During gastrulation and segmentation, expression is maintained in adaxial, intermediate, and lateral plate mesoderm. During late segmentation, expressed in several regions including the forming heart. By 24 hpf, expressed in the dorsal aorta, caudal vein, and intersomitic blood vessels. Ref.1

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Sequence caution: The sequence AAH97125.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The aplnrb aplnrb (Catalog #AAA1174985) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-359. The amino acid sequence is listed below: MNAMDNMTAD YSPDYFDDAV NSSMCEYDEW EPSYSLIPVL YMLIFILGLT GNGVVIFTVW RAQSKRRAAD VYIGNLALAD LTFVVTLPLW AVYTALGYHW PFGVALCKIS SYVVLLNMYA SVFCLTCLSL DRYMAIVHSL TSTQLRTRGH MRASLTAIWL LSGVLAAPTL LFRTTVYDVE TNRTSCAMDF NLVVSQPGQE TYWIAGLSIS STALGFLIPL LAMMVCYGFI GCTVTRHFNS LRKEDQRKRR LLKIITTLVV VFAACWMPFH VVKTMDALSY LNLAPDSCTF LNLLLLAHPY ATCLAYVNSC LNPLLYAFFD LRFRSQCLCL LNLKKALHAS PASSLSSQKT EAQSLATKV. It is sometimes possible for the material contained within the vial of "Apelin receptor B (aplnrb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.