(Rhesus macaque) Apelin receptor (APLNR) Recombinant Protein | APLNR recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) Apelin receptor (APLNR)
Gene Names
APLNR; APJ; AGTRL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Apelin receptor (APLNR); Recombinant Macaca mulatta (Rhesus macaque) Apelin receptor (APLNR); Recombinant (Rhesus macaque) Apelin receptor (APLNR); Apelin receptor; Angiotensin receptor-like 1 G-protein coupled receptor APJ; APLNR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-380
Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFSCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVFRTTGDLENTTKVQCYMDYSMVATVSSDWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Sequence Length
380
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,606 Da
NCBI Official Full Name
apelin receptor
NCBI Official Symbol
APLNR
NCBI Official Synonym Symbols
APJ; AGTRL1
NCBI Protein Information
apelin receptor; angiotensin receptor-like 1; G-protein coupled receptor APJ; angiotensin II receptor-like 1
UniProt Protein Name
Apelin receptor
Protein Family
UniProt Gene Name
APLNR
UniProt Synonym Gene Names
AGTRL1; APJ
UniProt Entry Name
APJ_MACMU
Uniprot Description
Function: Receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. Alternative coreceptor with CD4 for SIV infection.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The APLNR aplnr (Catalog #AAA1161668) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-380. The amino acid sequence is listed below: MEEGGDFDNY YGADNQSECE YTDWKSSGAL IPAIYMLVFL LGTTGNGLVL WTVFRSSREK RRSADIFIAS LAVADLTFVV TLPLWATYTY RDYDWPFGTF SCKLSSYLIF VNMYASVFCL TGLSFDRYLA IVRPVANARL RLRVSGAVAT AVLWVLAALL AMPVMVFRTT GDLENTTKVQ CYMDYSMVAT VSSDWAWEVG LGVSSTTVGF VVPFTIMLTC YFFIAQTIAG HFRKERIEGL RKRRRLLSII VVLVVTFALC WMPYHLVKTL YMLGSLLHWP CDFDLFLMNV FPYCTCISYV NSCLNPFLYA FFDPRFRQAC TSMLCCGQSR CAGTSHSSSG EKSASYSSGH SQGPGPNMGK GGEQMHEKSI PYSQETLVVD. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Apelin receptor (APLNR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
