Acylamino-acid-releasing enzyme (APEH) Recombinant Protein | APEH recombinant protein
Recombinant Bovine Acylamino-acid-releasing enzyme (APEH) , partial
Gene Names
APEH; APH; AARE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acylamino-acid-releasing enzyme (APEH); Recombinant Bovine Acylamino-acid-releasing enzyme (APEH); partial; APEH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
509-730. Partial
Sequence
HSSFVTSWMLLPAMLCKMGFAALLVNYRGSTGFGQDSILSLPGNVGSQDVKDVQFAVEQVLQEEHFDAGRVALLGGSHGGFLSCHLIGQYPETYGACVVRNPVINIASMMGSTDIPDWCVVEAGYLYSSDCLPDPNVWSEMLNKSPIKYTPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYPKSTHSLSEVEVESDSFMNAVIWMCTHLGH
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for APEH recombinant protein
This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81,093 Da
NCBI Official Full Name
acylamino-acid-releasing enzyme
NCBI Official Synonym Full Names
acylaminoacyl-peptide hydrolase
NCBI Official Symbol
APEH
NCBI Official Synonym Symbols
APH; AARE
NCBI Protein Information
acylamino-acid-releasing enzyme
UniProt Protein Name
Acylamino-acid-releasing enzyme
Protein Family
UniProt Gene Name
APEH
UniProt Synonym Gene Names
AARE; APH
Uniprot Description
This enzyme catalyzes the hydrolysis of the N-terminal peptide bond of an N-acetylated peptide to generate an N-acetylated amino acid and a peptide with a free N-terminus. It preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser.
Similar Products
Product Notes
The APEH apeh (Catalog #AAA958370) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 509-730. Partial. The amino acid sequence is listed below: HSSFVTSWML LPAMLCKMGF AALLVNYRGS TGFGQDSILS LPGNVGSQDV KDVQFAVEQV LQEEHFDAGR VALLGGSHGG FLSCHLIGQY PETYGACVVR NPVINIASMM GSTDIPDWCV VEAGYLYSSD CLPDPNVWSE MLNKSPIKYT PQVKTPVLLM LGQEDRRVPF KQGMEYYRAL KARNVPVRLL LYPKSTHSLS EVEVESDSFM NAVIWMCTHL GH . It is sometimes possible for the material contained within the vial of "Acylamino-acid-releasing enzyme (APEH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
