Amyloid beta A4 precursor protein-binding family B member 3 (Apbb3) Recombinant Protein | Apbb3 recombinant protein
Recombinant Mouse Amyloid beta A4 precursor protein-binding family B member 3 (Apbb3)
Gene Names
Apbb3; TR2S; Rirl2; Fe65l2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Amyloid beta A4 precursor protein-binding family B member 3 (Apbb3); Recombinant Mouse Amyloid beta A4 precursor protein-binding family B member 3 (Apbb3); Apbb3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-486, full length protein
Sequence
MLGKDYMLAIILVNCDDDLWGDQNLEGETGLPPGWRKIRDAAGTYYWHVPSGSTQWQRPTWELPGAEDPGRGTEGIWELRPPKGRSFSSLDSSLNRSNSLTWYSEDSYVRSLEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRNRSQPHDGTWGEGQNMLMILKKDAMSLLNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVAGDKDSCMLKCHVFHCDVPAKAIASALQGLCAQILSERVGVSGEAACCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGILPVTKAMGMDVLNEAIGTLTARGDRKTWVPAMLSVSDSLMTAHAIQAEAGAEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGCQSFQCAAFWCEPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPPPLLKGGAGGAGAAPRKRGVFSFLDAFRLKPSLLHMS
Sequence Length
486
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Apbb3 recombinant protein
This protein is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer s disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that This protein may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,638 Da
NCBI Official Full Name
amyloid-beta A4 protein-binding family B member 3 isoform 1
NCBI Official Synonym Full Names
amyloid beta (A4) precursor protein-binding, family B, member 3
NCBI Official Symbol
Apbb3
NCBI Official Synonym Symbols
TR2S; Rirl2; Fe65l2
NCBI Protein Information
amyloid-beta A4 precursor protein-binding family B member 3; amyloid beta A4 precursor protein-binding family B member 3
UniProt Protein Name
Amyloid-beta A4 precursor protein-binding family B member 3
Protein Family
UniProt Gene Name
Apbb3
Uniprot Description
May modulate the internalization of amyloid-beta precursor protein.
Similar Products
Product Notes
The Apbb3 apbb3 (Catalog #AAA1412566) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-486, full length protein. The amino acid sequence is listed below: MLGKDYMLAI ILVNCDDDLW GDQNLEGETG LPPGWRKIRD AAGTYYWHVP SGSTQWQRPT WELPGAEDPG RGTEGIWELR PPKGRSFSSL DSSLNRSNSL TWYSEDSYVR SLEPGAKCFA VRSLGWVEVP EEDLAPGKSS IAVNNCIQQL AQTRNRSQPH DGTWGEGQNM LMILKKDAMS LLNPLDHSLI HCQPLVHIRV WGVGSSKGRD RDFAFVAGDK DSCMLKCHVF HCDVPAKAIA SALQGLCAQI LSERVGVSGE AACCSPDPIS PEDLPRQVEL LDAVSQAAQK YEALYMGILP VTKAMGMDVL NEAIGTLTAR GDRKTWVPAM LSVSDSLMTA HAIQAEAGAE EEPLWQCPVR LVTFIGVGRD PHTFGLIADL GCQSFQCAAF WCEPHAGGLS EAVQAACMVQ YQKCLVASAA RGKAWGAQAR ARLRLKRTSS MDSPGGPLPP PLLKGGAGGA GAAPRKRGVF SFLDAFRLKP SLLHMS. It is sometimes possible for the material contained within the vial of "Amyloid beta A4 precursor protein-binding family B member 3 (Apbb3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
