Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AP-3 complex subunit mu-1 (AP3M1) Recombinant Protein | AP3M1 recombinant protein

Recombinant Chicken AP-3 complex subunit mu-1 (AP3M1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AP-3 complex subunit mu-1 (AP3M1); Recombinant Chicken AP-3 complex subunit mu-1 (AP3M1); AP3M1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-418, Full length protein
Sequence
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAIDVENVPPVISTPLHYLISIYRDKIFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSETAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVIEEIDAIIDKSGSTVFAEIQGVIDSCIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHLISFKENSSSGRFDVTIGPKQNMGKTVEGVVMTVHMPKAVLNMNLTATQGSYTFDPVTKVLAWDVGKITPQKLPNLKGIVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
Sequence Length
418
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AP3M1 recombinant protein
This protein is the medium subunit of AP-3, which is an adaptor-related protein complex associated with the Golgi region as well as more peripheral intracellular structures. AP-3 facilitates the budding of vesicles from the Golgi membrane and may be directly involved in protein sorting to the endosomal
lysosomal system. AP-3 is a heterotetrameric protein complex composed of two large subunits (delta and beta3), a medium subunit (mu3), and a small subunit (sigma 3). Mutations in one of the large subunits of AP-3 have been associated with the Hermansky-Pudlak syndrome, a genetic disorder characterized by defective lysosome-related organelles. Alternatively spliced transcript variants encoding the same protein have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,972 Da
NCBI Official Full Name
AP-3 complex subunit mu-1
NCBI Official Synonym Full Names
adaptor related protein complex 3 mu 1 subunit
NCBI Official Symbol
AP3M1
NCBI Protein Information
AP-3 complex subunit mu-1
UniProt Protein Name
AP-3 complex subunit mu-1
Protein Family
UniProt Gene Name
AP3M1

Uniprot Description

Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals ().

Similar Products

Product Notes

The AP3M1 ap3m1 (Catalog #AAA1353583) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-418, Full length protein. The amino acid sequence is listed below: MIHSLFLINC SGDIFLEKHW KSVVSQSVCD YFFEAQEKAI DVENVPPVIS TPLHYLISIY RDKIFFVSVI QTEVPPLFVI EFLHRVADTF QDYFGECSET AIKDNVVIVY ELLEEMLDNG FPLATESNIL KELIKPPTIL RSVVNSITGS SNVGDTLPTG QLSNIPWRRA GVKYTNNEAY FDVIEEIDAI IDKSGSTVFA EIQGVIDSCI KLSGMPDLSL SFMNPRLLDD VSFHPCIRFK RWESERVLSF IPPDGNFRLI SYRVSSQNLV AIPVYVKHLI SFKENSSSGR FDVTIGPKQN MGKTVEGVVM TVHMPKAVLN MNLTATQGSY TFDPVTKVLA WDVGKITPQK LPNLKGIVNL QSGAPKPEEN PSLNIQFKIQ QLAISGLKVN RLDMYGEKYK PFKGVKYITK AGKFQVRT. It is sometimes possible for the material contained within the vial of "AP-3 complex subunit mu-1 (AP3M1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.