AP-1 complex subunit mu-1 (AP1M1) Recombinant Protein | AP1M1 recombinant protein
Recombinant Human AP-1 complex subunit mu-1 (AP1M1)
Gene Names
AP1M1; AP47; CLTNM; MU-1A; CLAPM2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AP-1 complex subunit mu-1 (AP1M1); Recombinant Human AP-1 complex subunit mu-1 (AP1M1); AP1M1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-423, Full length protein
Sequence
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ
Sequence Length
422
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AP1M1 recombinant protein
This protein is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,840 Da
NCBI Official Full Name
AP-1 complex subunit mu-1 isoform 1
NCBI Official Synonym Full Names
adaptor related protein complex 1 mu 1 subunit
NCBI Official Symbol
AP1M1
NCBI Official Synonym Symbols
AP47; CLTNM; MU-1A; CLAPM2
NCBI Protein Information
AP-1 complex subunit mu-1
UniProt Protein Name
AP-1 complex subunit mu-1
Protein Family
UniProt Gene Name
AP1M1
UniProt Synonym Gene Names
CLTNM
NCBI Description
The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Research Articles on AP1M1
Similar Products
Product Notes
The AP1M1 ap1m1 (Catalog #AAA1418230) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-423, Full length protein. The amino acid sequence is listed below: SASAVYVLDL KGKVLICRNY RGDVDMSEVE HFMPILMEKE EEGMLSPILA HGGVRFMWIK HNNLYLVATS KKNACVSLVF SFLYKVVQVF SEYFKELEEE SIRDNFVIIY ELLDELMDFG YPQTTDSKIL QEYITQEGHK LETGAPRPPA TVTNAVSWRS EGIKYRKNEV FLDVIESVNL LVSANGNVLR SEIVGSIKMR VFLSGMPELR LGLNDKVLFD NTGRGKSKSV ELEDVKFHQC VRLSRFENDR TISFIPPDGE FELMSYRLNT HVKPLIWIES VIEKHSHSRI EYMIKAKSQF KRRSTANNVE IHIPVPNDAD SPKFKTTVGS VKWVPENSEI VWSIKSFPGG KEYLMRAHFG LPSVEAEDKE GKPPISVKFE IPYFTTSGIQ VRYLKIIEKS GYQALPWVRY ITQNGDYQLR TQ. It is sometimes possible for the material contained within the vial of "AP-1 complex subunit mu-1 (AP1M1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
