Annexin A1 (ANXA1) Recombinant Protein | ANXA1 recombinant protein

Recombinant Cavia cutleri (Guinea pig) Guinea pig Annexin A1 (ANXA1)

Cat. Num. AAA951323

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Annexin A1 (ANXA1); Recombinant Cavia cutleri (Guinea pig) Guinea pig Annexin A1 (ANXA1); ANXA1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-346, Full length protein
• Sequence: SMVSEFLKQAYFIDNQEQDYVKTVKSSKGGPGSAVSPYPSFDASSDVAALHKAITVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEEVVLALLKTPAQLDADELRAAMKGLGTDEDTLIEILVSRKNREIKEINRVYRDELKRDLAKDITSDTSGDFQKALLSLAKGDRCEDLSVNDDLADSDARALYEAGERRKGTDVNVFITILTTRSYSHLRRVFQKYTKYSQHDMNKALDLELKGDIENCLTAIVKCATSTPAFFAEKLHLAMKGAGTRHKALIRIMVSRSEIDMNDIKVYYQKMYGISLCQAILDETKGDYEKILVALCGGQ
• Sequence Length: 345

• Species: Cavia cutleri (Guinea pig)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ANXA1 recombinant protein

Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

NCBI and Uniprot Product Information

• NCBI GI #: 113942
• UniProt Accession #: P14087
• Molecular Weight: 38,555 Da
• NCBI Official Full Name: Annexin A1
• UniProt Protein Name: Annexin A1
• Protein Family: Annexin
• UniProt Gene Name: ANXA1
• UniProt Synonym Gene Names: ANX1

Uniprot Description

Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity. Plays a role in glucocorticoid-mediated down-regulation of the early phase of the inflammatory response. Promotes resolution of inflammation and wound healing (). Functions at least in part by activating the formyl peptide receptors and downstream signaling cascades. Promotes chemotaxis of granulocytes and monocytes via activation of the formyl peptide receptors (). Contributes to the adaptive immune response by enhancing signaling cascades that are triggered by T-cell activation, regulates differentiation and proliferation of activated T-cells. Promotes the differentiation of T-cells into Th1 cells and negatively regulates differentiation into Th2 cells (). Has no effect on unstimulated T-cells. Promotes rearrangement of the actin cytoskeleton, cell polarization and cell migration. Negatively regulates hormone exocytosis via activation of the formyl peptide receptors and reorganization of the actin cytoskeleton (). Has high affinity for Ca2+ and can bind up to eight Ca2+ ions (). Displays Ca2+-dependent binding to phospholipid membranes (PubMed:2962884). Plays a role in the formation of phagocytic cups and phagosomes. Plays a role in phagocytosis by mediating the Ca2+-dependent interaction between phagosomes and the actin cytoskeleton ().