Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACTH antigen

SYNTHETIC HUMAN ACTH (aa1-39)

Gene Names
POMC; LPH; MSH; NPP; POC; ACTH; CLIP
Applications
ELISA
Purity
HPLC: 98%
Synonyms
ACTH; SYNTHETIC HUMAN ACTH (aa1-39); ACTH antigen
Ordering
For Research Use Only!
Purity/Purification
HPLC: 98%
Form/Format
Purified
Purified synthetic ACTH - liquid
Concentration
Total protein concentration 1.0mg/ml (varies by lot)
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence Length
267
Applicable Applications for ACTH antigen
ELISA (EIA)
Preparation
Solid phase synthesis
Buffer Solution
Trifluoroacetate salt
Target Species
Human
Preparation and Storage
Store at -20°C only. Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use.

Ships with Dry Ice.

Shelf Life: 18 months from date of despatch.
Related Product Information for ACTH antigen
It is a synthetic peptide corresponding to full-length mature human ACTH, a secreted hormone that stimulates the synthesis and release of corticosteroids from the adrenal cortex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
4541 Da
NCBI Official Full Name
pro-opiomelanocortin preproprotein
NCBI Official Synonym Full Names
proopiomelanocortin
NCBI Official Symbol
POMC
NCBI Official Synonym Symbols
LPH; MSH; NPP; POC; ACTH; CLIP
NCBI Protein Information
pro-opiomelanocortin; adrenocorticotropic hormone; adrenocorticotropin; alpha-MSH; alpha-melanocyte-stimulating hormone; beta-LPH; beta-MSH; beta-endorphin; beta-melanocyte-stimulating hormone; corticotropin-like intermediary peptide; corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; melanotropin gamma; met-enkephalin; opiomelanocortin prepropeptide; pro-ACTH-endorphin; proopiomelanocortin preproprotein
UniProt Protein Name
Pro-opiomelanocortin
UniProt Gene Name
POMC
UniProt Synonym Gene Names
POMC; ACTH; CLIP
UniProt Entry Name
COLI_HUMAN

NCBI Description

This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. The antimicrobial melanotropin alpha peptide exhibits antibacterial and antifungal activity. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Nov 2014]

Uniprot Description

POMC: ACTH stimulates the adrenal glands to release cortisol. Defects in POMC may be associated with susceptibility to obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Defects in POMC are the cause of pro-opiomelanocortinin deficiency (POMCD). Affected individuals present early-onset obesity, adrenal insufficiency and red hair. Belongs to the POMC family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: extracellular space; peroxisomal matrix; cytoplasm; extracellular region; peroxisome; secretory granule

Molecular Function: type 3 melanocortin receptor binding; G-protein-coupled receptor binding; type 4 melanocortin receptor binding; hormone activity; receptor binding

Biological Process: generation of precursor metabolites and energy; cellular protein metabolic process; cell-cell signaling; neuropeptide signaling pathway; regulation of blood pressure; peptide hormone processing; regulation of appetite; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; signal transduction; glucose homeostasis; cellular pigmentation

Disease: Obesity; Proopiomelanocortin Deficiency

Research Articles on ACTH

Similar Products

Product Notes

The ACTH pomc (Catalog #AAA238022) is an Antigen and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACTH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Researchers should empirically determine the suitability of the ACTH pomc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SYSMEHFRWG KPVGKKRRPV KVYPNGAEDE SAEAFPLEF. It is sometimes possible for the material contained within the vial of "ACTH, Antigen" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.