Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-38 kDa.)

ANGPTL3/Angiopoietin-like 3 Recombinant Protein | ANGPTL3 recombinant protein

Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein

Gene Names
ANGPTL3; ANL3; ANG-5; FHBL2; ANGPT5
Purity
>90% by SDS-PAGE.
Synonyms
ANGPTL3/Angiopoietin-like 3; Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein; ANG-5; ANGPT5; ANL3; FHBL2; ANGPTL3 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKP
Sequence Length
460
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-38 kDa.)

SDS-Page (Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-38 kDa.)
Related Product Information for ANGPTL3 recombinant protein
Description: Recombinant Human ANGPTL3/Angiopoietin-like 3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Pro220) of human ANGPTL3/Angiopoietin-like 3 (Accession #NP_055310.1) fused with a 6xHis tag at the C-terminus.

Background: Angiopoietin-like protein 3 (ANGPTL3) also known as Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5) is a secreted glycoprotein that is structurally related to the angiopoietins.Human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. The fibrinogen C-terminal domain is sufficient to mediate endothelial cell adhesion. ANGPTL3 is principally expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism.ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids.
Product Categories/Family for ANGPTL3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Angiopoietin-related protein 3
NCBI Official Synonym Full Names
angiopoietin like 3
NCBI Official Symbol
ANGPTL3
NCBI Official Synonym Symbols
ANL3; ANG-5; FHBL2; ANGPT5
NCBI Protein Information
angiopoietin-related protein 3
UniProt Protein Name
Angiopoietin-related protein 3
UniProt Gene Name
ANGPTL3
UniProt Synonym Gene Names
ANGPT5; ANG-5
UniProt Entry Name
ANGL3_HUMAN

NCBI Description

This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015]

Uniprot Description

ANGPTL3: Defects in ANGPTL3 are the cause of familial hypobetalipoproteinemia type 2 (FHBL2); also called combined hypobetalipoproteinemia familial. FHBL2 is a disorder of lipid metabolism characterized by less than 5th percentile age- and sex-specific levels of low density lipoproteins, and dietary fat malabsorption. Affected individuals present with combined hypolipidemia, consisting of extremely low plasma levels of LDL cholesterol, HDL cholesterol, and triglycerides.

Protein type: Secreted; Cell adhesion; Inhibitor; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: extracellular space; cell surface

Molecular Function: integrin binding; enzyme inhibitor activity; phospholipase inhibitor activity; growth factor activity

Biological Process: integrin-mediated signaling pathway; cholesterol metabolic process; phospholipid catabolic process; glycerol metabolic process; cell-matrix adhesion; lipid homeostasis; positive regulation of lipid catabolic process; fatty acid metabolic process; signal transduction; sequestering of lipid; positive regulation of angiogenesis; cholesterol homeostasis; acylglycerol homeostasis; phospholipid metabolic process; artery morphogenesis; negative regulation of lipoprotein lipase activity; positive regulation of cell migration; phospholipid homeostasis

Disease: Hypobetalipoproteinemia, Familial, 2

Research Articles on ANGPTL3

Similar Products

Product Notes

The ANGPTL3 angptl3 (Catalog #AAA9141861) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SRIDQDNSSF DSLSPEPKSR FAMLDDVKIL ANGLLQLGHG LKDFVHKTKG QINDIFQKLN IFDQSFYDLS LQTSEIKEEE KELRRTTYKL QVKNEEVKNM SLELNSKLES LLEEKILLQQ KVKYLEEQLT NLIQNQPETP EHPEVTSLKT FVEKQDNSIK DLLQTVEDQY KQLNQQHSQI KEIENQLRRT SIQEPTEISL SSKP. It is sometimes possible for the material contained within the vial of "ANGPTL3/Angiopoietin-like 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.