Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Amelotin (AMTN) Recombinant Protein | AMTN recombinant protein

Recombinant Human Amelotin (AMTN)

Gene Names
AMTN; AI3B; UNQ689
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Amelotin (AMTN); Recombinant Human Amelotin (AMTN); AMTN recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-209, Full length protein
Sequence
LPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ
Sequence Length
193
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,459 Da
NCBI Official Full Name
amelotin isoform 2
NCBI Official Synonym Full Names
amelotin
NCBI Official Symbol
AMTN
NCBI Official Synonym Symbols
AI3B; UNQ689
NCBI Protein Information
amelotin
UniProt Protein Name
Amelotin
Protein Family
UniProt Gene Name
AMTN

NCBI Description

The mineralized portions of teeth, the dentin and enamel, are formed by mesenchyme-derived odontoblasts and epithelium-derived ameloblasts, respectively. As ameloblasts differentiate, they deposit specific proteins necessary for enamel formation, including amelogenin (AMELX; MIM 300391), enamelin (ENAM; MIM 606585), and ameloblastin (AMBN; MIM 601259), in the organic enamel matrix. Amelotin is specifically expressed in maturation-stage ameloblasts (Iwasaki et al., 2005 [PubMed 16304441]).[supplied by OMIM, Mar 2008]

Uniprot Description

Is a promoter of calcium phosphate mineralization, playing a critical role in the formation of the compact, mineralized, aprismatic enamel surface layer during the maturation stage of amelogenesis.

Research Articles on AMTN

Similar Products

Product Notes

The AMTN amtn (Catalog #AAA1424521) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-209, Full length protein. The amino acid sequence is listed below: LPQLKPALGL PPTKLAPDQG TLPNQQQSNQ VFPSLSLIPL TQMLTLGPDL HLLNPAAGMT PGTQTHPLTL GGLNVQQQLH PHVLPIFVTQ LGAQGTILSS EELPQIFTSL IIHSLFPGGI LPTSQAGANP DVQDGSLPAG GAGVNPATQG TPAGRLPTPS GTDDDFAVTT PAGIQRSTHA IEEATTESAN GIQ. It is sometimes possible for the material contained within the vial of "Amelotin (AMTN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual