Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Autocrine motility factor receptor, isoform 1 (AMFR) Recombinant Protein | AMFR recombinant protein

Recombinant Human Autocrine motility factor receptor, isoform 1 (AMFR), partial

Gene Names
AMFR; GP78; RNF45
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autocrine motility factor receptor; isoform 1 (AMFR); Recombinant Human Autocrine motility factor receptor; partial; AMFR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-110\naa, Extracellular domain
Sequence
ARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLAAARNGGFRSSRPPSAPLPSSAASCALCPTDWRRPVPILPLHGKAGLTALPLYKAC
Sequence Length
643
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
267
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,996 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase AMFR isoform c
NCBI Official Synonym Full Names
autocrine motility factor receptor
NCBI Official Symbol
AMFR
NCBI Official Synonym Symbols
GP78; RNF45
NCBI Protein Information
E3 ubiquitin-protein ligase AMFR
UniProt Protein Name
E3 ubiquitin-protein ligase AMFR
UniProt Gene Name
AMFR
UniProt Synonym Gene Names
RNF45; AMF receptor

NCBI Description

This locus encodes a glycosylated transmembrane receptor. Its ligand, autocrine motility factor, is a tumor motility-stimulating protein secreted by tumor cells. The encoded receptor is also a member of the E3 ubiquitin ligase family of proteins. It catalyzes ubiquitination and endoplasmic reticulum-associated degradation of specific proteins. [provided by RefSeq, Feb 2012]

Uniprot Description

E3 ubiquitin-protein ligase that mediates the polyubiquitination of a number of proteins such as CD3D, CYP3A4, CFTR and APOB for proteasomal degradation. Component of a VCP/p97-AMFR/gp78 complex that participates in the final step of endoplasmic reticulum-associated degradation (ERAD). The VCP/p97-AMFR/gp78 complex is involved in the sterol-accelerated ERAD degradation of HMGCR through binding to the HMGCR-INSIG complex at the ER membrane and initiating ubiquitination of HMGCR. The ubiquitinated HMGCR is then released from the ER by the complex into the cytosol for subsequent destruction. Also regulates ERAD through the ubiquitination of UBL4A a component of the BAG6/BAT3 complex. Also acts as a scaffold protein to assemble a complex that couples ubiquitination, retranslocation and deglycosylation. Mediates tumor invasion and metastasis as a receptor for the GPI/autocrine motility factor.

Research Articles on AMFR

Similar Products

Product Notes

The AMFR amfr (Catalog #AAA1126158) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-110naa, Extracellular domain. The amino acid sequence is listed below: ARKRFLNKSS EDDAASESFL PSEGASSDPV TLRRRMLAAA RNGGFRSSRP PSAPLPSSAA SCALCPTDWR RPVPILPLHG KAGLTALPLY KAC. It is sometimes possible for the material contained within the vial of "Autocrine motility factor receptor, isoform 1 (AMFR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.