Putative Dol-P-Glc:Glc (2)Man (9)GlcNAc (2)-PP-Dol alpha-1,2-glucosyltransferase (Alg10b) Recombinant Protein | Alg10b recombinant protein
Recombinant Rat Putative Dol-P-Glc:Glc (2)Man (9)GlcNAc (2)-PP-Dol alpha-1,2-glucosyltransferase (Alg10b), partial
Gene Names
Alg10; KCR1; Alg10b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative Dol-P-Glc:Glc (2)Man (9)GlcNAc (2)-PP-Dol alpha-1; 2-glucosyltransferase (Alg10b); Recombinant Rat Putative Dol-P-Glc:Glc (2)Man (9)GlcNAc (2)-PP-Dol alpha-1; partial; Alg10b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-474
Sequence
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGRFSLSQWDPMITTLPGLYLVSVGVVKPASWILGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFRKIQPRNKASSSIQRILSTLTLAVFPTLYFFNFLYYTEAGSVFFTLFAYLMCLYGNHRTSALLGFCGFMFRQTNIIWAAFCAGHIIAQKCSEAWKTELQKKKEERLPPAKGPLSELRRVLQFLLMYSMSLKNLSMLFLLTWPYMLLLLAFFVFVVVNGGIVVGDRSSHEACLHFPQLFYFFSFTAFFSFPHLLSPTKVKTFLSLVWKRRVQFSVITLVSVFLVWKFTYVHKYLLADNRHYTFYVWKRVFQRHEIVKYLLVPAYMFAGWAVADSLKSKSIFWNLMFFVCLVASTVPQKLLEFRYFILPYIIYRLNMPLPPISRLVCELGCYAVVNFLTFYIFLNKTFQWSDSHDIQRFMW
Sequence Length
474
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,574 Da
NCBI Official Full Name
putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
NCBI Official Synonym Full Names
ALG10, alpha-1,2-glucosyltransferase
NCBI Official Symbol
Alg10
NCBI Official Synonym Symbols
KCR1; Alg10b
NCBI Protein Information
putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
UniProt Protein Name
Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
UniProt Gene Name
Alg10b
UniProt Synonym Gene Names
Kcr1
NCBI Description
regulatory component of non-inactivating K+ channels [RGD, Feb 2006]
Uniprot Description
Putative alpha-1,2-glucosyltransferase, which adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc2-PP-Dol (). When coupled to KCNH2 may reduce KCNH2 sensitivity to classic proarrhythmic drug blockade, possibly by mediating glycosylation of KCNH2 (PubMed:9722534, PubMed:14525949). Has a role in maintenance of cochlear outer hair cell function ().
Research Articles on Alg10b
Similar Products
Product Notes
The Alg10b alg10b (Catalog #AAA1241443) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-474. The amino acid sequence is listed below: MAQLEGYYFS AALSCTFLVS CLLFSAFSRA LREPYMDEIF HLPQAQRYCE GRFSLSQWDP MITTLPGLYL VSVGVVKPAS WILGWSEHVV CSIGMLRFVN LLFSVGNFYL LYLLFRKIQP RNKASSSIQR ILSTLTLAVF PTLYFFNFLY YTEAGSVFFT LFAYLMCLYG NHRTSALLGF CGFMFRQTNI IWAAFCAGHI IAQKCSEAWK TELQKKKEER LPPAKGPLSE LRRVLQFLLM YSMSLKNLSM LFLLTWPYML LLLAFFVFVV VNGGIVVGDR SSHEACLHFP QLFYFFSFTA FFSFPHLLSP TKVKTFLSLV WKRRVQFSVI TLVSVFLVWK FTYVHKYLLA DNRHYTFYVW KRVFQRHEIV KYLLVPAYMF AGWAVADSLK SKSIFWNLMF FVCLVASTVP QKLLEFRYFI LPYIIYRLNM PLPPISRLVC ELGCYAVVNF LTFYIFLNKT FQWSDSHDIQ RFMW. It is sometimes possible for the material contained within the vial of "Putative Dol-P-Glc:Glc (2)Man (9)GlcNAc (2)-PP-Dol alpha-1,2-glucosyltransferase (Alg10b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
