Aldehyde Dehydrogenase, Mitochondrial (ALDM) Recombinant Protein | ALDM recombinant protein

Recombinant Aldehyde Dehydrogenase, Mitochondrial (ALDM)

Cat. Num. AAA2009669

• Gene Names: ALDH2; ALDM; ALDHI; ALDH-E2
• Applications: SDS-Page, Western Blot, ELISA, Immunoprecipitation
• Purity: > 95%
• Synonyms: Aldehyde Dehydrogenase; Mitochondrial (ALDM); Recombinant Aldehyde Dehydrogenase; ALDM recombinant protein

• Host: E Coli
• Purity/Purification: > 95%
• Form/Format: Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
• Sequence: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.; MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PS TGEVICQVAE GDKEDVDKAV KAARAAFQLG SPWRRMDASH RGRLLNRLAD LIERDRTYLA ALETLDNGKP YVISYLVDLD MVLKCLRYYA
• Sequence Length: 517

• Applicable Applications for ALDM recombinant protein: SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
• Organism: Homo sapiens (Human)
• Expression System: Prokaryotic expression
• Residues: Pro59~Ala150 (Accession # P05091) with two N-terminal Tags, His-tag and S-tag
• Endotoxin Level: <1.0EU per 1ug (determined by the LAL method)
• Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.
• Preparation and Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.; Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

• NCBI GI #: 25777732
• NCBI GeneID: 217
• NCBI Accession #: NP_000681.2
• NCBI GenBank Nucleotide #: NM_000690.3
• UniProt Accession #: P05091; Q03639; Q6IB13; Q6IV71; B4DW54; E7EUE5
• Molecular Weight: 16.1kDa
• NCBI Official Full Name: aldehyde dehydrogenase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: aldehyde dehydrogenase 2 family (mitochondrial)
• NCBI Official Symbol: ALDH2
• NCBI Official Synonym Symbols: ALDM; ALDHI; ALDH-E2
• NCBI Protein Information: aldehyde dehydrogenase, mitochondrial; ALDH class 2; liver mitochondrial ALDH; acetaldehyde dehydrogenase 2; nucleus-encoded mitochondrial aldehyde dehydrogenase 2
• UniProt Protein Name: Aldehyde dehydrogenase, mitochondrial
• UniProt Gene Name: ALDH2
• UniProt Synonym Gene Names: ALDM
• UniProt Entry Name: ALDH2_HUMAN

NCBI Description

This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2011]

Uniprot Description

ALDH2: This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2011]

Protein type: Mitochondrial; Carbohydrate Metabolism - pyruvate; Amino Acid Metabolism - tryptophan; Carbohydrate Metabolism - propanoate; Amino Acid Metabolism - lysine degradation; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lipid Metabolism - fatty acid; EC 1.2.1.3; Other Amino Acids Metabolism - beta-alanine; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - histidine; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Oxidoreductase; Carbohydrate Metabolism - ascorbate and aldarate; Lipid Metabolism - glycerolipid; Amino Acid Metabolism - arginine and proline; Carbohydrate Metabolism - butanoate

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrial matrix

Molecular Function: aldehyde dehydrogenase (NAD) activity; electron carrier activity; aldehyde dehydrogenase [NAD(P)+] activity

Biological Process: synaptic transmission; ethanol catabolic process; xenobiotic metabolic process; carbohydrate metabolic process; alcohol metabolic process; ethanol oxidation; neurotransmitter biosynthetic process

Disease: Alcohol Sensitivity, Acute