L-alanine exporter AlaE (alaE) Recombinant Protein | CKO_04017 recombinant protein
Recombinant Citrobacter koseri L-alanine exporter AlaE (alaE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-alanine exporter AlaE (alaE); Recombinant Citrobacter koseri L-alanine exporter AlaE (alaE); Recombinant L-alanine exporter AlaE (alaE); L-alanine exporter AlaE; CKO_04017 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-149
Sequence
MFSPQSRLRHAVADTFAMVVYCSVVNMLIEIFLSGMTFEQSLSSRLVAIPVNILIAWPYGMYRDAIMRVARKASPASWVKNLADVLAYVTFQSPVYVAILLTVGADWHQITAAVSSNIVISMLMGAVYGYFLDYCRRLFKVSSYHQAKA
Sequence Length
149
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,685 Da
NCBI Official Full Name
hypothetical protein CKO_04017
NCBI Official Symbol
CKO_04017
NCBI Protein Information
hypothetical protein
UniProt Protein Name
L-alanine exporter AlaE
UniProt Gene Name
alaE
UniProt Entry Name
ALAE_CITK8
Uniprot Description
Function: Exports L-alanine
By similarity. HAMAP-Rule MF_00914
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00914.
Sequence similarities: Belongs to the AlaE exporter family.
Sequence caution: The sequence ABV15089.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
Similar Products
Product Notes
The CKO_04017 alae (Catalog #AAA1052039) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-149. The amino acid sequence is listed below: MFSPQSRLRH AVADTFAMVV YCSVVNMLIE IFLSGMTFEQ SLSSRLVAIP VNILIAWPYG MYRDAIMRVA RKASPASWVK NLADVLAYVT FQSPVYVAIL LTVGADWHQI TAAVSSNIVI SMLMGAVYGY FLDYCRRLFK VSSYHQAKA. It is sometimes possible for the material contained within the vial of "L-alanine exporter AlaE (alaE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
