Alcohol dehydrogenase [NADP (+)] (Akr1a1) Recombinant Protein | Akr1a1 recombinant protein
Recombinant Rat Alcohol dehydrogenase [NADP (+)] (Akr1a1)
Gene Names
Akr1a1; Akr1a4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alcohol dehydrogenase [NADP (+)] (Akr1a1); Recombinant Rat Alcohol dehydrogenase [NADP (+)] (Akr1a1); Akr1a1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-325, Full length protein
Sequence
TASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY
Sequence Length
324
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Akr1a1 recombinant protein
This gene encodes a member of the aldo
keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Alternative splicing of this gene results in two transcript variants encoding the same protein.
keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Alternative splicing of this gene results in two transcript variants encoding the same protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,506 Da
NCBI Official Full Name
alcohol dehydrogenase
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member A1
NCBI Official Symbol
Akr1a1
NCBI Official Synonym Symbols
Akr1a4
NCBI Protein Information
alcohol dehydrogenase [NADP(+)]
UniProt Protein Name
Alcohol dehydrogenase [NADP(+)]
Protein Family
UniProt Gene Name
Akr1a1
UniProt Synonym Gene Names
Alr
NCBI Description
enzyme that catalyzes the NADPH-dependent reduction of 3-deoxyglucosone; important for detoxifying 3-deoxyglucosone when it is formed through the Maillard reaction in vivo [RGD, Feb 2006]
Uniprot Description
Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs (). Catalyzes the NADPH-dependent reduction of 3-deoxyglucosone (3-DG).
Similar Products
Product Notes
The Akr1a1 akr1a1 (Catalog #AAA717623) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-325, Full length protein. The amino acid sequence is listed below: TASSVLLHTG QKMPLIGLGT WKSEPGQVKA AIKYALSVGY RHIDCASVYG NETEIGEALK ESVGAGKAVP REELFVTSKL WNTKHHPEDV EPAVRKTLAD LQLEYLDLYL MHWPYAFERG DNPFPKNADG TVKYDSTHYK ETWKALEALV AKGLVKALGL SNFSSRQIDD VLSVASVRPA VLQVECHPYL AQNELIAHCQ ARGLEVTAYS PLGSSDRAWR HPDEPVLLEE PVVLALAEKH GRSPAQILLR WQVQRKVICI PKSITPSRIL QNIQVFDFTF SPEEMKQLDA LNKNWRYIVP MITVDGKRVP RDAGHPLYPF NDPY. It is sometimes possible for the material contained within the vial of "Alcohol dehydrogenase [NADP (+)] (Akr1a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
