Angiotensinogen (AGT) Recombinant Protein | AGT recombinant protein
Recombinant Angiotensinogen (AGT)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFELRRQ-AGDRVYIH PFHLLYHNKS TCAQLENPS VETLPESTFEP VPIQAKTSPV NEKTLHDQLV LAAEKLEDED RKRAAQVAMI ANFVGFRMYK MLNEAGSGAS GAILSPPALF GTLVSFYLGS LDPTASQLQT LLDVPVKEGD CTSRLDGHKV LAALRAVQGL LVTQGGSSSQ TPLLQSIMVG LFTAPGFRLK HSFVQSLALF TPALFPRSLD LSTDPVLATE KINRFIKAVT GWKMNLPLEG VSTDSTLLFN TYVHFQGTMR GFSQLPGVHE FWVDNSISVS VPMISGTGNF QHWSDAQNNF SVTCVPLGER ATLLLIQPHC TSDLDRVEAL IFRNDLLTWI ENPPPRAIRL TLPQLEIRGS YNLQDLLAED KLPTLLGAEA NLSNIGDTNP RVGEVLNSIL LELKAGEEEQ PTTSVQQPGS PEALDVTLSS PFLFAIYEQD SGTLHFLGRV NNPQSVV
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
Uniprot Description
angiotensin: Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1- 8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2. Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT). Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause. Defects in AGT are a cause of renal tubular dysgenesis (RTD). RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Belongs to the serpin family.
Protein type: Secreted, signal peptide; Secreted
Cellular Component: extracellular space; cytoplasm
Molecular Function: angiotensin receptor binding; serine-type endopeptidase inhibitor activity; sodium channel regulator activity; hormone activity; type 2 angiotensin receptor binding; type 1 angiotensin receptor binding
Biological Process: positive regulation of catalytic activity; renal system process; extracellular matrix organization and biogenesis; positive regulation of nitric oxide biosynthetic process; establishment of blood-nerve barrier; negative regulation of nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; positive regulation of multicellular organism growth; positive regulation of vasodilation; ovarian follicle rupture; regulation of apoptosis; positive regulation of fibroblast proliferation; regulation of systemic arterial blood pressure by circulatory renin-angiotensin; cell surface receptor linked signal transduction; positive regulation of superoxide release; negative regulation of neuron apoptosis; kidney development; angiotensin mediated regulation of renal output; regulation of calcium ion transport; response to muscle activity involved in regulation of muscle adaptation; regulation of norepinephrine secretion; brain renin-angiotensin system; negative regulation of tissue remodeling; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of peptidyl-tyrosine phosphorylation; phospholipase C activation; angiotensin mediated vasoconstriction involved in regulation of systemic arterial blood pressure; regulation of gene expression; regulation of transmission of nerve impulse; smooth muscle cell differentiation; cytokine secretion; positive regulation of blood pressure; regulation of long-term neuronal synaptic plasticity; peristalsis; cell-matrix adhesion; drinking behavior; positive regulation of cellular protein metabolic process; renin-angiotensin regulation of aldosterone production; smooth muscle cell proliferation; excretion; vasodilation; response to salt stress; negative regulation of cell proliferation; positive regulation of MAPKKK cascade; fibroblast proliferation; positive regulation of epidermal growth factor receptor signaling pathway; regulation of blood pressure; positive regulation of cell proliferation; angiotensin mediated drinking behavior; artery smooth muscle contraction; positive regulation of fatty acid biosynthetic process; blood vessel development; vasoconstriction; cellular sodium ion homeostasis; renal response to blood flow during renin-angiotensin regulation of systemic arterial blood pressure; activation of NF-kappaB-inducing kinase; positive regulation of organ growth; positive regulation of peptidyl-serine phosphorylation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; ureteric bud branching; regulation of inflammatory response; hormone metabolic process; negative regulation of cell growth; response to cold; astrocyte activation
Research Articles on AGT
Similar Products
Product Notes
The AGT agt (Catalog #AAA2011101) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Angiotensinogen (AGT) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the AGT agt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EFELRRQ-AG DRVYIH PFHLLYHNKS TCAQLENPS VETLPESTFE P VPIQAKTSPV NEKTLHDQLV LAAEKLEDED RKRAAQVAMI ANFVGFRMYK MLNEAGSGAS GAILSPPALF GTLVSFYLGS LDPTASQLQT LLDVPVKEGD CTSRLDGHKV LAALRAVQGL LVTQGGSSSQ TPLLQSIMVG LFTAPGFRLK HSFVQSLALF TPALFPRSLD LSTDPVLATE KINRFIKAVT GWKMNLPLEG VSTDSTLLFN TYVHFQGTMR GFSQLPGVHE FWVDNSISVS VPMISGTGNF QHWSDAQNNF SVTCVPLGER ATLLLIQPHC TSDLDRVEAL IFRNDLLTWI ENPPPRAIRL TLPQLEIRGS YNLQDLLAED KLPTLLGAEA NLSNIGDTNP RVGEVLNSIL LELKAGEEEQ PTTSVQQPGS PEALDVTLSS PFLFAIYEQD SGTLHFLGRV NNPQSVV. It is sometimes possible for the material contained within the vial of "Angiotensinogen (AGT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.