Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-1B adrenergic receptor (ADRA1B) Recombinant Protein | ADRA1B recombinant protein

Recombinant Mesocricetus auratus Alpha-1B adrenergic receptor (ADRA1B)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-1B adrenergic receptor (ADRA1B); Recombinant Mesocricetus auratus Alpha-1B adrenergic receptor (ADRA1B); ADRA1B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-515
Sequence
MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLPSASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESPGTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF
Sequence Length
515
Species
Mesocricetus auratus (Golden hamster)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for ADRA1B recombinant protein
ADRA1B

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
56,493 Da
NCBI Official Full Name
Alpha-1B adrenergic receptor
UniProt Protein Name
Alpha-1B adrenergic receptor
UniProt Gene Name
ADRA1B
UniProt Synonym Gene Names
Alpha-1B adrenoceptor
UniProt Entry Name
ADA1B_MESAU

Uniprot Description

ADRA1B: a G protein-coupled catecholamine receptor that activates mitogenic responses and regulates growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. Can induce neoplastic transformation when transfected into cell lines. Can regulate the phosphorylation status of the STAT3 pathway. Mediates blood pressure and aorta contractile responses induced by alpha-1 agonists. Activates a phosphatidylinositol second messenger system.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Similar Products

Product Notes

The Alpha-1B adrenergic receptor (ADRA1B) adra1b (Catalog #AAA1048977) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-515. The amino acid sequence is listed below: MNPDLDTGHN TSAPAQWGEL KDANFTGPNQ TSSNSTLPQL DVTRAISVGL VLGAFILFAI VGNILVILSV ACNRHLRTPT NYFIVNLAIA DLLLSFTVLP FSATLEVLGY WVLGRIFCDI WAAVDVLCCT ASILSLCAIS IDRYIGVRYS LQYPTLVTRR KAILALLSVW VLSTVISIGP LLGWKEPAPN DDKECGVTEE PFYALFSSLG SFYIPLAVIL VMYCRVYIVA KRTTKNLEAG VMKEMSNSKE LTLRIHSKNF HEDTLSSTKA KGHNPRSSIA VKLFKFSREK KAAKTLGIVV GMFILCWLPF FIALPLGSLF STLKPPDAVF KVVFWLGYFN SCLNPIIYPC SSKEFKRAFM RILGCQCRSG RRRRRRRRLG ACAYTYRPWT RGGSLERSQS RKDSLDDSGS CMSGSQRTLP SASPSPGYLG RGAQPPLELC AYPEWKSGAL LSLPEPPGRR GRLDSGPLFT FKLLGEPESP GTEGDASNGG CDATTDLANG QPGFKSNMPL APGHF. It is sometimes possible for the material contained within the vial of "Alpha-1B adrenergic receptor (ADRA1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.