Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (C17orf48) Recombinant Protein | C17orf48 recombinant protein
Recombinant Human Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (C17orf48)
Gene Names
ADPRM; MDS006; C17orf48; NBLA03831
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (C17orf48); Recombinant Human Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (C17orf48); C17orf48 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-342, Full length protein
Sequence
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
Sequence Length
342
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,010 Da
NCBI Official Full Name
manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
NCBI Official Synonym Full Names
ADP-ribose/CDP-alcohol diphosphatase, manganese dependent
NCBI Official Symbol
ADPRM
NCBI Official Synonym Symbols
MDS006; C17orf48; NBLA03831
NCBI Protein Information
manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
UniProt Protein Name
Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
UniProt Gene Name
ADPRM
UniProt Synonym Gene Names
C17orf48
Uniprot Description
Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress ().
Research Articles on C17orf48
Similar Products
Product Notes
The C17orf48 adprm (Catalog #AAA1405754) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-342, Full length protein. The amino acid sequence is listed below: MDDKPNPEAL SDSSERLFSF GVIADVQFAD LEDGFNFQGT RRRYYRHSLL HLQGAIEDWN NESSMPCCVL QLGDIIDGYN AQYNASKKSL ELVMDMFKRL KVPVHHTWGN HEFYNFSREY LTHSKLNTKF LEDQIVHHPE TMPSEDYYAY HFVPFPKFRF ILLDAYDLSV LGVDQSSPKY EQCMKILREH NPNTELNSPQ GLSEPQFVQF NGGFSQEQLN WLNEVLTFSD TNQEKVVIVS HLPIYPDASD NVCLAWNYRD ALAVIWSHEC VVCFFAGHTH DGGYSEDPFG VYHVNLEGVI ETAPDSQAFG TVHVYPDKMM LKGRGRVPDR IMNYKKERAF HC. It is sometimes possible for the material contained within the vial of "Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (C17orf48), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
