Adiponectin receptor protein 1 (ADIPOR1) Recombinant Protein | ADIPOR1 recombinant protein

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial

Cat. Num. AAA7135873

• Gene Names: ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Adiponectin receptor protein 1 (ADIPOR1); Recombinant Human Adiponectin receptor protein 1 (ADIPOR1); partial; Progestin and adipoQ receptor family member 1; (Progestin and adipoQ receptor family member I); (PAQR1); (TESBP1A); ADIPOR1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 89-375aa; Partial
• Sequence: EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
• Sequence Length: 375

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Tag: N-terminal 6xHis-DYKDDDDK-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for ADIPOR1 recombinant protein

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin.

Product Categories/Family for ADIPOR1 recombinant protein

Cardiovascular

References

"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 38372248
• NCBI GeneID: 51094
• UniProt Accession #: Q96A54
• Molecular Weight: 34.8kDa
• NCBI Official Full Name: Adiponectin receptor protein 1
• NCBI Official Synonym Full Names: adiponectin receptor 1
• NCBI Official Symbol: ADIPOR1
• NCBI Official Synonym Symbols: CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
• NCBI Protein Information: adiponectin receptor protein 1
• UniProt Protein Name: Adiponectin receptor protein 1
• Protein Family: Adiponectin receptor protein
• UniProt Gene Name: ADIPOR1
• UniProt Synonym Gene Names: PAQR1; TESBP1A
• UniProt Entry Name: ADR1_HUMAN

NCBI Description

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

Uniprot Description

ADIPOR1: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin. Belongs to the ADIPOR family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: adiponectin binding; identical protein binding; hormone binding; protein heterodimerization activity; receptor activity; protein kinase binding

Biological Process: hormone-mediated signaling; adiponectin-mediated signaling pathway; positive regulation of JAK-STAT cascade; fatty acid oxidation; negative regulation of cell growth; positive regulation of insulin receptor signaling pathway; leptin-mediated signaling pathway