Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable G-protein coupled receptor 114 (Gpr114) Recombinant Protein | Gpr114 recombinant protein

Recombinant Mouse Probable G-protein coupled receptor 114 (Gpr114)

Gene Names
Adgrg5; PGR27; Gm1109; Gpr114
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 114 (Gpr114); Recombinant Mouse Probable G-protein coupled receptor 114 (Gpr114); Gpr114 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-523aa; full length protein
Sequence
LSDLLVLMKRLEQPVGRGLSSRARHIHSLEQKLLNASFGGHNLTLQTNSIQSLVFNLSCD FPGLSLSSTTLTNVSQVRAPHAMQFPAELTKGACVTSRPAELRLICIYFFTAHLFQDDRN SSLLNNYVLGAQLDHRPVNNLQKPVNISFWHNRSLEGYTVSCVFWKEGASKSSWGAWSPE GCYTEQPSATQVLCHCNHLTYFAVLMLSGDPVPAELQVPLEYISFVGCSISIVASLLTIL LYAQSRKQSDSTTRIHMNLNGSVLLLNVTFLLSSQMTLPTMPRPVCKVLAAVLHYALLSS LTWMAIEGFNLYLFLGRVYNAYIRRYLLKLCMLGWGFPALLVLLLLMIKSSVYGPCVTSL SKSQENGTGFQNVSMCWIRSPMVHSILVMGYGGFTSLFNLVVLAWALWILCRLRAREKAL SPWAYRDTAMVLGLTVLLGTTWTLAFFSFGVFLLPQLFLFTIFNSLYGFFLFLWFCSQKR YSDAEAKAEMEAVSSSQMTH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr114 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,547 Da
NCBI Official Full Name
adhesion G-protein coupled receptor G5 isoform 2
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor G5
NCBI Official Symbol
Adgrg5
NCBI Official Synonym Symbols
PGR27; Gm1109; Gpr114
NCBI Protein Information
adhesion G-protein coupled receptor G5
UniProt Protein Name
Adhesion G-protein coupled receptor G5
UniProt Gene Name
Adgrg5
UniProt Synonym Gene Names
Gm1109; Gpr114; Pgr27
UniProt Entry Name
AGRG5_MOUSE

Uniprot Description

GPR114: Orphan receptor. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2

Cellular Component: integral to membrane; membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity; transmembrane receptor activity

Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; signal transduction

Similar Products

Product Notes

The Gpr114 adgrg5 (Catalog #AAA7016065) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-523aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr114 adgrg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSDLLVLMKR LEQPVGRGLS SRARHIHSLE QKLLNASFGG HNLTLQTNSI QSLVFNLSCD FPGLSLSSTT LTNVSQVRAP HAMQFPAELT KGACVTSRPA ELRLICIYFF TAHLFQDDRN SSLLNNYVLG AQLDHRPVNN LQKPVNISFW HNRSLEGYTV SCVFWKEGAS KSSWGAWSPE GCYTEQPSAT QVLCHCNHLT YFAVLMLSGD PVPAELQVPL EYISFVGCSI SIVASLLTIL LYAQSRKQSD STTRIHMNLN GSVLLLNVTF LLSSQMTLPT MPRPVCKVLA AVLHYALLSS LTWMAIEGFN LYLFLGRVYN AYIRRYLLKL CMLGWGFPAL LVLLLLMIKS SVYGPCVTSL SKSQENGTGF QNVSMCWIRS PMVHSILVMG YGGFTSLFNL VVLAWALWIL CRLRAREKAL SPWAYRDTAM VLGLTVLLGT TWTLAFFSFG VFLLPQLFLF TIFNSLYGFF LFLWFCSQKR YSDAEAKAEM EAVSSSQMTH. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 114 (Gpr114), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.