A disintegrin and metalloproteinase with thrombospondin motifs 1 (Adamts1) Recombinant Protein | Adamts1 recombinant protein
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 1 (Adamts1)
Gene Names
Adamts1; C3-C5; METH1; ADAMTS; METH-1; ADAM-TS1; ADAMTS-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 1 (Adamts1); Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 1 (Adamts1); Adamts1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
254-968, Full length protein
Sequence
FVSSPRYVETMLVADQSMADFHGSGLKHYLLTLFSVAARFYKHPSIRNSISLVVVKILVIYEEQKGPEVTSNAALTLRNFCSWQKQHNSPSDRDPEHYDTAILFTRQDLCGSHTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKHCASLNGVSGDSHLMASMLSSLDHSQPWSPCSAYMVTSFLDNGHGECLMDKPQNPIKLPSDLPGTLYDANRQCQFTFGEESKHCPDAASTCTTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCVSGKCVNKTDMKHFATPVHGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPDNNGKTFREEQCEAHNEFSKASFGNEPTVEWTPKYAGVSPKDRCKLTCEAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGNGSTCKKMSGIVTSTRPGYHDIVTIPAGATNIEVKHRNQRGSRNNGSFLAIRAADGTYILNGNFTLSTLEQDLTYKGTVLRYSGSSAALERIRSFSPLKEPLTIQVLMVGHALRPKIKFTYFMKKKTESFNAIPTFSEWVIEEWGECSKTCGSGWQRRVVQCRDINGHPASECAKEVKPASTRPCADLPCPHWQVGDWSPCSKTCGKGYKKRTLKCVSHDGGVLSNESCDPLKKPKHYIDFCTLTQCS
Sequence Length
715
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Adamts1 recombinant protein
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. This protein contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
105,801 Da
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 1 preproprotein
NCBI Official Synonym Full Names
a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 1
NCBI Official Symbol
Adamts1
NCBI Official Synonym Symbols
C3-C5; METH1; ADAMTS; METH-1; ADAM-TS1; ADAMTS-1
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 1
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 1
UniProt Gene Name
Adamts1
UniProt Synonym Gene Names
ADAM-TS 1; ADAM-TS1; ADAMTS-1
NCBI Description
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family and preproprotein that is proteolytically processed to generate a mature protein product. This secreted protein product plays an important role in ovulation, likely through its cleavage of the extracellular matrix component versican. The encoded protein may enhance tumorigenesis in a mouse model of breast cancer. Homozygous knockout mice for this gene exhibit enhanced perinatal lethality, impaired growth and adipose tissue development, and impaired ovulation in females. [provided by RefSeq, Oct 2015]
Uniprot Description
Cleaves aggrecan, a cartilage proteoglycan, at the '1691-Glu-|-Leu-1692' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover. Has angiogenic inhibitor activity (). Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture ().
Research Articles on Adamts1
Similar Products
Product Notes
The Adamts1 adamts1 (Catalog #AAA950471) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 254-968, Full length protein. The amino acid sequence is listed below: FVSSPRYVET MLVADQSMAD FHGSGLKHYL LTLFSVAARF YKHPSIRNSI SLVVVKILVI YEEQKGPEVT SNAALTLRNF CSWQKQHNSP SDRDPEHYDT AILFTRQDLC GSHTCDTLGM ADVGTVCDPS RSCSVIEDDG LQAAFTTAHE LGHVFNMPHD DAKHCASLNG VSGDSHLMAS MLSSLDHSQP WSPCSAYMVT SFLDNGHGEC LMDKPQNPIK LPSDLPGTLY DANRQCQFTF GEESKHCPDA ASTCTTLWCT GTSGGLLVCQ TKHFPWADGT SCGEGKWCVS GKCVNKTDMK HFATPVHGSW GPWGPWGDCS RTCGGGVQYT MRECDNPVPK NGGKYCEGKR VRYRSCNIED CPDNNGKTFR EEQCEAHNEF SKASFGNEPT VEWTPKYAGV SPKDRCKLTC EAKGIGYFFV LQPKVVDGTP CSPDSTSVCV QGQCVKAGCD RIIDSKKKFD KCGVCGGNGS TCKKMSGIVT STRPGYHDIV TIPAGATNIE VKHRNQRGSR NNGSFLAIRA ADGTYILNGN FTLSTLEQDL TYKGTVLRYS GSSAALERIR SFSPLKEPLT IQVLMVGHAL RPKIKFTYFM KKKTESFNAI PTFSEWVIEE WGECSKTCGS GWQRRVVQCR DINGHPASEC AKEVKPASTR PCADLPCPHW QVGDWSPCSK TCGKGYKKRT LKCVSHDGGV LSNESCDPLK KPKHYIDFCT LTQCS. It is sometimes possible for the material contained within the vial of "A disintegrin and metalloproteinase with thrombospondin motifs 1 (Adamts1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
