C-C motif chemokine 22 Recombinant Protein | CCL22 recombinant protein

C-C motif chemokine 22

Cat. Num. AAA7042391

• Gene Names: ADAM11; MDC
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 22; CCL22 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 226-769aa; full length protein
• Sequence: QVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CCL22 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for CCL22 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 4585710
• NCBI GeneID: 4185
• NCBI Accession #: NP_002381.2
• NCBI GenBank Nucleotide #: NM_002390.5
• UniProt Accession #: O75078; Q14808; Q14809; Q14810; AAB29191
• Molecular Weight: 57,911 Da
• NCBI Official Full Name: disintegrin and metalloproteinase domain-containing protein 11 isoform 1 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase domain 11
• NCBI Official Symbol: ADAM11
• NCBI Official Synonym Symbols: MDC
• NCBI Protein Information: disintegrin and metalloproteinase domain-containing protein 11
• UniProt Protein Name: Disintegrin and metalloproteinase domain-containing protein 11
• Protein Family: C-C motif chemokine
• UniProt Gene Name: ADAM11
• UniProt Synonym Gene Names: MDC; ADAM 11; MDC
• UniProt Entry Name: ADA11_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

ADAM11: Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protease; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: extracellular matrix; plasma membrane

Molecular Function: integrin binding; metallopeptidase activity

Biological Process: integrin-mediated signaling pathway