Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ACVR2A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)

ACVR2A recombinant protein

Recombinant Human ACVR2A Protein

Gene Names
ACVR2A; ACVR2; ACTRII
Purity
>95% by SDS-PAGE.
Synonyms
ACVR2A; Recombinant Human ACVR2A Protein; Activin Receptor Type-2A; Activin Receptor Type IIA; ACTR-IIA; ACTRIIA; ACVR2; ACVR2A recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Sequence
AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP
Sequence Length
513
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ACVR2A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)

SDS-Page (Recombinant Human ACVR2A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)
Related Product Information for ACVR2A recombinant protein
Description: Recombinant Human ACVR2A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala20-Pro134) of human ACVR2A (Accession #P27037) fused with a 6xHis tag at the C-terminus.

Background: This protein is a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
Product Categories/Family for ACVR2A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
92
UniProt Accession #
NCBI Official Full Name
activin type II receptor
NCBI Official Synonym Full Names
activin A receptor type 2A
NCBI Official Symbol
ACVR2A
NCBI Official Synonym Symbols
ACVR2; ACTRII
NCBI Protein Information
activin receptor type-2A
UniProt Protein Name
Activin receptor type-2A
Protein Family
UniProt Gene Name
ACVR2A
UniProt Synonym Gene Names
ACVR2; ACTR-IIA; ACTRIIA
UniProt Entry Name
AVR2A_HUMAN

NCBI Description

This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

ACVR2A: a tyrosine-kinase like receptor kinase of the STKR family. The holoreceptor receptor is a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. Each is composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic kinase domain. Type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptor kinases are apparently constitutively active.

Protein type: EC 2.7.11.30; Protein kinase, TKL; Kinase, protein; Motility/polarity/chemotaxis; Membrane protein, integral; Protein kinase, Ser/Thr (receptor); TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 2q22.3

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; plasma membrane; receptor complex

Molecular Function: activin receptor activity; protein self-association; metal ion binding; transmembrane receptor protein serine/threonine kinase activity; PDZ domain binding; transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; growth factor binding; activin binding; coreceptor activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: positive regulation of erythrocyte differentiation; embryonic skeletal development; regulation of BMP signaling pathway; activin receptor signaling pathway; Sertoli cell proliferation; gastrulation with mouth forming second; positive regulation of bone mineralization; protein amino acid phosphorylation; BMP signaling pathway; anterior/posterior pattern formation; positive regulation of osteoblast differentiation; positive regulation of activin receptor signaling pathway; transmembrane receptor protein serine/threonine kinase signaling pathway; mesoderm development; spermatogenesis; regulation of nitric-oxide synthase activity; sperm ejaculation; positive regulation of protein amino acid phosphorylation; determination of left/right symmetry; penile erection

Research Articles on ACVR2A

Similar Products

Product Notes

The ACVR2A acvr2a (Catalog #AAA9141909) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AILGRSETQE CLFFNANWEK DRTNQTGVEP CYGDKDKRRH CFATWKNISG SIEIVKQGCW LDDINCYDRT DCVEKKDSPE VYFCCCEGNM CNEKFSYFPE MEVTQPTSNP VTPKP. It is sometimes possible for the material contained within the vial of "ACVR2A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.