Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BTC active protein

BTC, Recombinant, Human (Probetacellulin, Betacellulin)

Purity
Highly Purified
~97% (SDS-PAGE, HPLC)
Synonyms
BTC; Recombinant; Human (Probetacellulin; Betacellulin); BTC active protein
Ordering
For Research Use Only!
Purity/Purification
Highly Purified
~97% (SDS-PAGE, HPLC)
Form/Format
Supplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4. Reconstitute with sterile ddH2O to 100ug/ml.
Sequence
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY
Specific Activity
>2×10e7IU/mg.
Biological Activity
The ED50, calculated by the dose-dependent proliferation of murine BALBC 3T3 cells (measured by 3H-thymidine uptake) is <0.05ng/ml.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for BTC active protein
Human Betacellulin (BTC) is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the egf receptor and other related receptors. Human Recombinant BTC produced in E.coli is a single, non- glycosylated, polypeptide chain containing 80aa and having a molecular mass of 9kD. BTC was purified by proprietary chromatographic techniques.
Product Categories/Family for BTC active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
685
UniProt Accession #
Molecular Weight
~9kD
NCBI Official Full Name
betacellulin
NCBI Official Synonym Full Names
betacellulin
NCBI Official Symbol
BTC
NCBI Protein Information
probetacellulin
UniProt Protein Name
Probetacellulin
Protein Family
UniProt Gene Name
BTC
UniProt Synonym Gene Names
BTC
UniProt Entry Name
BTC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

BTC: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Protein type: Cell cycle regulation; Ligand, receptor tyrosine kinase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; integral to membrane; plasma membrane; extracellular region

Molecular Function: protein binding; growth factor activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of fibroblast proliferation; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; positive regulation of mitosis; positive regulation of cell proliferation; innate immune response; positive regulation of cell differentiation; negative regulation of apoptosis

Research Articles on BTC

Similar Products

Product Notes

The BTC btc (Catalog #AAA636302) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DGNSTRSPET NGLLCGDPEE NCAATTTQSK RKGHFSRCPK QYKHYCIKGR CRFVVA EQTPSCVCDE GYIGARCERV DLFY. It is sometimes possible for the material contained within the vial of "BTC, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.