Acriflavine resistance protein A (acrA) Recombinant Protein | acrA recombinant protein
Recombinant Escherichia coli Acriflavine resistance protein A (acrA)
Gene Names
acrA; ECK0457; JW0452; lir; Mb; mbl; mtcA; nbsA; sipB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acriflavine resistance protein A (acrA); Recombinant Escherichia coli Acriflavine resistance protein A (acrA); acrA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-397, full length protein
Sequence
CDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS
Sequence Length
373
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,197 Da
NCBI Official Full Name
multidrug efflux system
NCBI Official Symbol
acrA
NCBI Official Synonym Symbols
ECK0457; JW0452; lir; Mb; mbl; mtcA; nbsA; sipB
NCBI Protein Information
multidrug efflux system
UniProt Protein Name
Multidrug efflux pump subunit AcrA
Protein Family
UniProt Gene Name
acrA
UniProt Synonym Gene Names
lir; mtcA
NCBI Description
acrA was first identified as an acridine sensitive mutation. acrA is a mutational suppressor of topA deletion inviability in low osmolarity medium. [More information is available at EcoGene: EG11703]. AcrA is the periplasmic lipoprotein component of the AcrAB-TolC multidrug efflux pump in Escherichia coli and can function in chimeric constructions with three other RND-family pumps, AcrD, AcrF and YhiV. [More information is available at EcoCyc: EG11703].
Uniprot Description
AcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with broad substrate specificity that uses the proton motive force to export substrates. This subunit may act as an adapter protein that links AcrB and TolC stably together. It is elongated in shape, being long enough to span the periplasm.
Research Articles on acrA
Similar Products
Product Notes
The acrA acra (Catalog #AAA1094204) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-397, full length protein. The amino acid sequence is listed below: CDDKQAQQGG QQMPAVGVVT VKTEPLQITT ELPGRTSAYR IAEVRPQVSG IILKRNFKEG SDIEAGVSLY QIDPATYQAT YDSAKGDLAK AQAAANIAQL TVNRYQKLLG TQYISKQEYD QALADAQQAN AAVTAAKAAV ETARINLAYT KVTSPISGRI GKSNVTEGAL VQNGQATALA TVQQLDPIYV DVTQSSNDFL RLKQELANGT LKQENGKAKV SLITSDGIKF PQDGTLEFSD VTVDQTTGSI TLRAIFPNPD HTLLPGMFVR ARLEEGLNPN AILVPQQGVT RTPRGDATVL VVGADDKVET RPIVASQAIG DKWLVTEGLK AGDRVVISGL QKVRPGVQVK AQEVTADNNQ QAASGAQPEQ SKS. It is sometimes possible for the material contained within the vial of "Acriflavine resistance protein A (acrA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
