1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (Abhd5) Recombinant Protein | Abhd5 recombinant protein
Recombinant Mouse 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (Abhd5)
Gene Names
Abhd5; CDS; IECN5; NCIE2; CGI-58; 1300003D03Rik; 2010002J10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (Abhd5); Recombinant Mouse 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (Abhd5); Abhd5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351, full length protein
Sequence
MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD
Sequence Length
351
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Abhd5 recombinant protein
This protein belongs to a large family of proteins defined by an alpha
beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase
lipase
thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase
lipase
thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,846 Da
NCBI Official Full Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 isoform 1
NCBI Official Synonym Full Names
abhydrolase domain containing 5
NCBI Official Symbol
Abhd5
NCBI Official Synonym Symbols
CDS; IECN5; NCIE2; CGI-58; 1300003D03Rik; 2010002J10Rik
NCBI Protein Information
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
UniProt Protein Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
Protein Family
UniProt Gene Name
Abhd5
UniProt Synonym Gene Names
Protein CGI-58
Uniprot Description
Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis (PubMed:16679289). May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2 (PubMed:16679289). Involved in keratinocyte differentiation (PubMed:16679289). Regulates lipid droplet fusion (PubMed:26083785).
Research Articles on Abhd5
Similar Products
Product Notes
The Abhd5 abhd5 (Catalog #AAA1470838) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351, full length protein. The amino acid sequence is listed below: MKAMAAEEEV DSADAGGGSG WLTGWLPTWC PTSTSHLKEA EEKMLKCVPC TYKKEPVRIS NGNRIWTLMF SHNISSKTPL VLLHGFGGGL GLWALNFEDL STDRPVYAFD LLGFGRSSRP RFDSDAEEVE NQFVESIEEW RCALRLDKMI LLGHNLGGFL AAAYSLKYPS RVSHLILVEP WGFPERPDLA DQERPIPVWI RALGAALTPF NPLAGLRIAG PFGLSLVQRL RPDFKRKYSS MFEDDTVTEY IYHCNVQTPS GETAFKNMTI PYGWAKRPML QRIGGLHPDI PVSVIFGARS CIDGNSGTSI QSLRPKSYVK TIAILGAGHY VYADQPEEFN QKVKEICHTV D. It is sometimes possible for the material contained within the vial of "1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (Abhd5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
