Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 polyclonal antibody. Lane 1: MAGEA11 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MAGEA11 Polyclonal Antibody | anti-MAGEA11 antibody

MAGEA11 (Melanoma-associated Antigen 11, MAGE-11 Antigen, Cancer/Testis Antigen 1.11, CT1.10, MAGE11, MGC10511)

Gene Names
MAGEA11; CT1.11; MAGE11; MAGE-11; MAGEA-11
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
MAGEA11; Polyclonal Antibody; MAGEA11 (Melanoma-associated Antigen 11; MAGE-11 Antigen; Cancer/Testis Antigen 1.11; CT1.10; MAGE11; MGC10511); Anti -MAGEA11 (Melanoma-associated Antigen 11; anti-MAGEA11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAGEA11.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
Applicable Applications for anti-MAGEA11 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human MAGEA11, aa1-319.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 polyclonal antibody. Lane 1: MAGEA11 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 polyclonal antibody. Lane 1: MAGEA11 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MAGEA11 transfected lysate using MAGEA11 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAGEA11 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MAGEA11 transfected lysate using MAGEA11 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAGEA11 mouse polyclonal antibody.)
Related Product Information for anti-MAGEA11 antibody
MAGEA11 is a member of the MAGEA gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 80% sequence identity between each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are expressed at a high level in a number of tumors of various histologic types, and are silent in normal tissues with the exception of testis and placenta. The MAGEA genes are clustered on chromosome Xq28. They may be implicated in some hereditary disorders, such as dyskeratosis congenita.
Product Categories/Family for anti-MAGEA11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,129 Da
NCBI Official Full Name
melanoma-associated antigen 11 isoform a
NCBI Official Synonym Full Names
melanoma antigen family A, 11
NCBI Official Symbol
MAGEA11
NCBI Official Synonym Symbols
CT1.11; MAGE11; MAGE-11; MAGEA-11
NCBI Protein Information
melanoma-associated antigen 11; MAGE-11 antigen; cancer/testis antigen 1.11; cancer/testis antigen family 1, member 11
UniProt Protein Name
Melanoma-associated antigen 11
UniProt Gene Name
MAGEA11
UniProt Synonym Gene Names
MAGE11; CT1.11
UniProt Entry Name
MAGAB_HUMAN

NCBI Description

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MAGE-A11: Acts as androgen receptor co-regulator that increases androgen receptor activity by modulating the receptors interdomain interaction. May play a role in embryonal development and tumor transformation or aspects of tumor progression. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Research Articles on MAGEA11

Similar Products

Product Notes

The MAGEA11 magea11 (Catalog #AAA6007067) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEA11 (Melanoma-associated Antigen 11, MAGE-11 Antigen, Cancer/Testis Antigen 1.11, CT1.10, MAGE11, MGC10511) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the MAGEA11 magea11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPLEQRSQHC KPEEGLQAQE EDLGLVGAQA LQAEEQEAAF FSSTLNVGTL EELPAAESPS PPQSPQEESF SPTAMDAIFG SLSDEGSGSQ EKEGPSTSPD LIDPESFSQD ILHDKIIDLV HLLLRKYRVK GLITKAEMLG SVIKNYEDYF PEIFREASVC MQLLFGIDVK EVDPTSHSYV LVTSLNLSYD GIQCNEQSMP KSGLLIIVLG VIFMEGNCIP EEVMWEVLSI MGVYAGREHF LFGEPKRLLT QNWVQEKYLV YRQVPGTDPA CYEFLWGPRA HAETSKMKVL EYIANANGRD PTSYPSLYED ALREEGEGV. It is sometimes possible for the material contained within the vial of "MAGEA11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.