ATP-binding cassette sub-family G member 2 (Abcg2) Recombinant Protein | Abcg2 recombinant protein

Recombinant Rat ATP-binding cassette sub-family G member 2 (Abcg2)

Cat. Num. AAA7007149

• Gene Names: Abcg2; BCRP1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP-binding cassette sub-family G member 2 (Abcg2); Recombinant Rat ATP-binding cassette sub-family G member 2 (Abcg2); Abcg2 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-657aa; full length protein
• Sequence: MSSSNDHVLVPMSQRNKNGLPGMSSRGARTLAEGDVLSFHHITYRVKVKSGFLVRKTAEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPRGLSGDVLINGAPQPANFKCSS GYVVQDDVVMGTLTVRENLQFSAALRLPKAMKTHEKNERINTIIKELGLDKVADSKVGTQ FTRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLMFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNRGEQDHEANKTEEPSKREKPIIENLAEFYINSTIYGETKAELDQLPVAQKKKG SSAFREPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGALYFGLKNDP TGMQNRAGVFFFLTTNQCFTSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKLVSDLLP MRFLPSVIYTCILYFMLGLKRTVEAFFIMMFTLIMVAYTASSMALAIAAGQSVVSVATLL MTISFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQHNEFLGQEFCPGLNVTMN STCVNSYTICTGNDYLINQGIDLSPWGLWRNHVALACMIIIFLTIAYLKLLFLKKYS
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Rat
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Abcg2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 31077114
• NCBI GeneID: 312382
• NCBI Accession #: NP_852046.1
• NCBI GenBank Nucleotide #: NM_181381.2
• UniProt Accession #: Q80W57; Q80ST1; Q80UR3; Q80XF3
• Molecular Weight: 72,961 Da
• NCBI Official Full Name: ATP-binding cassette sub-family G member 2
• NCBI Official Synonym Full Names: ATP-binding cassette, subfamily G (WHITE), member 2
• NCBI Official Symbol: Abcg2
• NCBI Official Synonym Symbols: BCRP1
• NCBI Protein Information: ATP-binding cassette sub-family G member 2
• UniProt Protein Name: ATP-binding cassette sub-family G member 2
• Protein Family: ABC transporter G family
• UniProt Gene Name: Abcg2
• UniProt Synonym Gene Names: Bcrp1
• UniProt Entry Name: ABCG2_RAT

Uniprot Description

ABCG2: Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. When overexpressed, the transfected cells become resistant to mitoxantrone, daunorubicin and doxorubicin, display diminished intracellular accumulation of daunorubicin, and manifest an ATP- dependent increase in the efflux of rhodamine 123. Monomer or homodimer; disulfide-linked. Up-regulated in brain tumors. Highly expressed in placenta. Low expression in small intestine, liver and colon. Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, iron; Transporter, ABC family; Membrane protein, integral; Membrane protein, multi-pass; Transporter

Cellular Component: apical plasma membrane; integral to membrane; membrane; mitochondrial membrane; nucleus; plasma membrane

Molecular Function: ATP binding; ATPase activity, coupled to transmembrane movement of substances; drug transporter activity; protein dimerization activity; protein homodimerization activity

Biological Process: drug export; drug transport; embryonic process involved in female pregnancy; multidrug transport; response to folic acid; response to iron ion; urate metabolic process