Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family G member 2 (Abcg2) Recombinant Protein | Abcg2 recombinant protein

Recombinant Mouse ATP-binding cassette sub-family G member 2 (Abcg2)

Gene Names
Abcg2; MXR; ABCP; BCRP; MXR1; ABC15; Bcrp1; AI428558
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family G member 2 (Abcg2); Recombinant Mouse ATP-binding cassette sub-family G member 2 (Abcg2); Abcg2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-657aa; full length protein
Sequence
MSSSNDHVLVPMSQRNNNGLPRTNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCS GYVVQDDVVMGTLTVRENLQFSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQ FIRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELDQLPGAQEKKG TSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLP MRFLPSVIFTCVLYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLL MTIAFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDN STCVNSYAICTGNEYLINQGIELSPWGLWKNHVALACMIIIFLTIAYLKLLFLKKYS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abcg2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,978 Da
NCBI Official Full Name
ATP-binding cassette sub-family G member 2
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family G (WHITE), member 2
NCBI Official Symbol
Abcg2
NCBI Official Synonym Symbols
MXR; ABCP; BCRP; MXR1; ABC15; Bcrp1; AI428558
NCBI Protein Information
ATP-binding cassette sub-family G member 2
UniProt Protein Name
ATP-binding cassette sub-family G member 2
Protein Family
UniProt Gene Name
Abcg2
UniProt Synonym Gene Names
Abcp; Bcrp1
UniProt Entry Name
ABCG2_MOUSE

NCBI Description

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, the human protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. This protein likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCG2: Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. When overexpressed, the transfected cells become resistant to mitoxantrone, daunorubicin and doxorubicin, display diminished intracellular accumulation of daunorubicin, and manifest an ATP- dependent increase in the efflux of rhodamine 123. Monomer or homodimer; disulfide-linked. Up-regulated in brain tumors. Highly expressed in placenta. Low expression in small intestine, liver and colon. Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, iron; Membrane protein, multi-pass; Membrane protein, integral; Transporter, ABC family; Transporter

Cellular Component: apical plasma membrane; integral to membrane; membrane; mitochondrion; nucleus; plasma membrane

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; drug transporter activity; nucleotide binding; protein dimerization activity; protein homodimerization activity

Biological Process: drug export; drug transport; embryonic process involved in female pregnancy; multidrug transport; transmembrane transport; transport; urate metabolic process

Research Articles on Abcg2

Similar Products

Product Notes

The Abcg2 abcg2 (Catalog #AAA7007147) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-657aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abcg2 abcg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSSNDHVLV PMSQRNNNGL PRTNSRAVRT LAEGDVLSFH HITYRVKVKS GFLVRKTVEK EILSDINGIM KPGLNAILGP TGGGKSSLLD VLAARKDPKG LSGDVLINGA PQPAHFKCCS GYVVQDDVVM GTLTVRENLQ FSAALRLPTT MKNHEKNERI NTIIKELGLE KVADSKVGTQ FIRGISGGER KRTSIGMELI TDPSILFLDE PTTGLDSSTA NAVLLLLKRM SKQGRTIIFS IHQPRYSIFK LFDSLTLLAS GKLVFHGPAQ KALEYFASAG YHCEPYNNPA DFFLDVINGD SSAVMLNREE QDNEANKTEE PSKGEKPVIE NLSEFYINSA IYGETKAELD QLPGAQEKKG TSAFKEPVYV TSFCHQLRWI ARRSFKNLLG NPQASVAQLI VTVILGLIIG AIYFDLKYDA AGMQNRAGVL FFLTTNQCFS SVSAVELFVV EKKLFIHEYI SGYYRVSSYF FGKVMSDLLP MRFLPSVIFT CVLYFMLGLK KTVDAFFIMM FTLIMVAYTA SSMALAIATG QSVVSVATLL MTIAFVFMML FSGLLVNLRT IGPWLSWLQY FSIPRYGFTA LQYNEFLGQE FCPGFNVTDN STCVNSYAIC TGNEYLINQG IELSPWGLWK NHVALACMII IFLTIAYLKL LFLKKYS. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family G member 2 (Abcg2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.