Kynurenine/alpha-aminoadipate aminotransferase Recombinant Protein | AADAT recombinant protein

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial

Cat. Num. AAA1356655

• Gene Names: AADAT; KAT2; KATII
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kynurenine/alpha-aminoadipate aminotransferase; Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase; mitochondrial; 2-aminoadipate aminotransferase; 2-aminoadipate transaminase (EC:2.6.1.39); Alpha-aminoadipate aminotransferase; AadAT; Kynurenine aminotransferase II; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase 2 (EC:2.6.1.7); Kynurenine--oxoglutarate transaminase II; AADAT recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 30-425aa; Full Length
• Sequence: PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
• Sequence Length: 425

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for AADAT recombinant protein

Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).

Product Categories/Family for AADAT recombinant protein

Signal Transduction

References

Cloning of human L-kynurenine/alpha-aminoadipate aminotransferase cDNA from brain tissue.Gatti S., Breton J., Mostardini M., Mosca M., Tarroni P., Schwarcz R., Speciale C., Okuno E., Toma S., Benatti L. Characterization of the human gene encoding alpha-aminoadipate aminotransferase (AADAT) .Goh D.L.M., Patel A., Thomas G.H., Salomons G.S., Schor D.S.M., Jakobs C., Geraghty M.T.Mol. Genet. Metab. 76:172-180(2002) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II.Han Q., Cai T., Tagle D.A., Robinson H., Li J.Biosci. Rep. 28:205-215(2008) Crystal structure of human kynurenine aminotransferase II.Han Q., Robinson H., Li J.J. Biol. Chem. 283:3567-3573(2008) Crystal structure of human kynurenine aminotransferase II, a drug target for the treatment of schizophrenia.Rossi F., Garavaglia S., Montalbano V., Walsh M.A., Rizzi M.J. Biol. Chem. 283:3559-3566(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 557878723
• NCBI GeneID: 51166
• NCBI Accession #: NP_001273611.1
• NCBI GenBank Nucleotide #: NM_001286682.1
• UniProt Accession #: Q8N5Z0; Q9UL02; B3KP84
• Molecular Weight: 60.2 kDa
• NCBI Official Full Name: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial isoform a
• NCBI Official Synonym Full Names: aminoadipate aminotransferase
• NCBI Official Symbol: AADAT
• NCBI Official Synonym Symbols: KAT2; KATII
• NCBI Protein Information: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
• UniProt Protein Name: Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
• Protein Family: Kynurenine/alpha-aminoadipate aminotransferase
• UniProt Gene Name: AADAT
• UniProt Synonym Gene Names: KAT2; KAT/AadAT; AadAT
• UniProt Entry Name: AADAT_HUMAN

NCBI Description

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

AADAT: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino- group acceptors, with a preference for 2-oxoglutarate, 2- oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - lysine biosynthesis; EC 2.6.1.39; Mitochondrial; EC 2.6.1.7; Amino Acid Metabolism - tryptophan; Amino Acid Metabolism - lysine degradation; Transferase

Chromosomal Location of Human Ortholog: 4q33

Cellular Component: mitochondrial matrix

Molecular Function: 2-aminoadipate transaminase activity; kynurenine-oxoglutarate transaminase activity; protein homodimerization activity; pyridoxal phosphate binding

Biological Process: 2-oxoglutarate metabolic process; biosynthetic process; glutamate metabolic process; L-lysine catabolic process to acetyl-CoA via saccharopine; lysine catabolic process; tryptophan catabolic process; tryptophan catabolic process to kynurenine